KEGG   Alicycliphilus denitrificans K601: Alide2_2726Help
Entry
Alide2_2726       CDS       T01463                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Alide2_2726
Enzymes [BR:adk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Alide2_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2854807..2856348)
Genome map
AA seq 513 aa AA seqDB search
MTAQMHEAGRAKEAGNRLQAWRTGIDTYQEPVVYMRRDCPVCRSEGFTTQARVQLTAGGR
SIVATLSVVDGDWLAENVAGLSESAWASLGAQPGEPVAVTHAPPLDSLSHVRAKVYGNSL
GDAEFGAIISDVAAGRYSDLHLATFITACAGDRLDLAETVSLTKAMIAVGDRIDWGRPLV
VDKHCVGGLPGNRTTLLVVPIVTACGLMMPKTSSRAITSPAGTADTMEVLAPVNLDVPSM
RRVVERTGGCIVWGGSVRLSPADDILIRVERPLDLDSEGQLVASVLSKKAAAGSTHVLID
LPVGATAKVRSAHAAASLGRRLQEVGGAIGLQVFLRVTDGEQPVGRGIGPALEARDVLAV
LQGKPEAPADLRERALRLAADILEMGGAAPAGGGLKLATEVLADGRAWAKFQAICSEQGG
LRSLPMAAHLHTVESPATGRVTRIDNRLLARAAKLAGAPTAPAAGIDVHARLGDRVEAGQ
PLFTLHAQAPGELAYALEFVRARPPIFQISEHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgcaaatgcatgaagccggccgcgccaaggaggccgggaacaggctgcaggcg
tggcgcacgggcatcgacacctatcaggagcctgtggtctacatgcggcgcgattgcccg
gtctgtcgatcggagggcttcacgacccaggcgcgcgtgcaattgacggccggcggccga
agcatcgtggcgacgctcagtgtcgtcgacggtgattggctggccgagaacgttgccggt
ctgtccgagtccgcatgggcatcgctgggtgcgcagccgggtgagccggtagcggtcacc
catgcgccaccgctggattcgctcagccatgtccgggccaaggtctacggcaactccctt
ggcgacgccgagttcggcgcgatcatctccgacgtcgcggcgggccgttactcggacctg
cacctcgccaccttcatcaccgcctgcgcgggcgatcgcctcgacctggcggagacggtc
tcgctcacgaaagccatgatcgccgtcggcgaccgcatcgattggggccgtccgctggtc
gtggacaagcactgcgtcggcggcctgcctgggaatcgcacgaccctgctcgtggtgccc
atcgtgaccgcctgcggcctcatgatgcccaagacctcctcgcgcgccatcacctcaccg
gccgggacggccgacacgatggaggtgctggcaccggtcaacctggatgtgccgagcatg
cgacgcgtggtcgagcgcacgggcggctgcatcgtgtggggcggctcggtccggctcagc
cccgccgacgacatccttatccgcgtcgagcggccactcgatctcgacagcgaagggcag
ctcgtggcctcggtcctgtccaagaaggccgctgcgggttcgacccatgtgctgatcgat
ctgcccgtgggcgccaccgcgaaagtgcgcagcgcacacgccgcggcgtcgctcggccgg
cgcctgcaggaggtggggggcgccataggcctgcaggtgttcttgcgcgtcaccgacggc
gaacagccggtcggccgcgggatcggccccgcactggaagcacgcgacgtgctggccgtc
ctgcagggtaaacccgaggccccggccgacctgcgggagcgggcgctgcggctggcggcg
gacattctcgaaatgggcggcgcggcgccggccggcggcggcctgaagctcgccaccgag
gtgctggccgatggccgggcctgggccaagttccaggcaatctgctctgagcagggcggc
cttcgaagcctcccgatggcggcgcatctgcacaccgtcgaatcgccggccacgggccgt
gtcacccgcatcgacaaccgcctgctcgcgcgggcggccaagctcgccggtgcgccgacc
gccccggccgccggcatcgatgtgcacgcgcgccttggcgatcgcgtcgaagccggacag
ccgctgttcacgctgcatgcccaggcaccaggcgaactggcctatgccctggagttcgtc
cgcgcgcgcccaccgatcttccagatttcagagcacgcatga

DBGET integrated database retrieval system