KEGG   Alicycliphilus denitrificans K601: Alide2_2806Help
Entry
Alide2_2806       CDS       T01463                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Alide2_2806
Secretion system [BR:adk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Alide2_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2933353..2934198
Genome map
AA seq 281 aa AA seqDB search
MMATTDPVRARRPRFAARLLPAALCAVLLAAATPGQATTPDETRLLGALRMAHPGTQFTE
VARTEVEGLYEVWMNGNVAYVTAANPRFFVFGRLFDTASMRDITGPRIAQRSAAQGAQLQ
SESTSAAPVSIDQLPLNDAIKTVRGNGQRKVAVFSDPNCIYCKQLEPEVAGIDNVTVYTF
LVPFQGEARPVAIWCSADRERAWRQWMLQADASLQQPTASCEHPIARNLELARRLGVQGT
PTLIWADGTRTDGYVGRQVLEARLAEAAKSASKPASTGKRP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaactactgaccccgtgcgcgcgcggcgccctcgtttcgccgcaaggcttctc
cctgcggcgctgtgcgcggtgctgctggccgccgccacccccggccaagccacgacgccc
gacgaaacccgcctgctcggcgcgctgcgcatggcccatcccggcacccagttcaccgag
gtggcacgcaccgaggtcgagggcctctacgaggtctggatgaacggcaacgtggcctac
gtcacggccgccaacccgcgcttcttcgtgttcggccgcctcttcgacacggccagcatg
cgcgacatcacgggccccaggatcgcacagcgtagcgctgcccaaggtgctcaactccag
tcggagtcgacgtcggcagcacccgtctcgatcgaccagttgccgctgaacgacgcgatc
aagaccgtgcgcggcaatggccagcgcaaggtcgcggtcttcagcgatccgaactgcatc
tactgcaagcagctggagcccgaggtcgctggcatcgacaacgtcactgtctacaccttc
ctcgtgcccttccagggcgaggcccggccggtcgcgatctggtgctccgccgaccgcgag
cgcgcctggcggcaatggatgctgcaagctgacgcgagtctgcagcagccgactgcaagc
tgcgagcacccgatcgcgcgcaacctcgaactggcacgcaggctcggggtgcagggaaca
cccacgctgatctgggccgacggcacgcgcaccgacggctacgtcggccgccaggtgctg
gaggcccggctcgccgaagccgccaagtccgcatccaagccggccagcacggggaaacgg
ccatga

DBGET integrated database retrieval system