KEGG   Alicycliphilus denitrificans K601: Alide2_2860Help
Entry
Alide2_2860       CDS       T01463                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Alide2_2860
Enzymes [BR:adk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Alide2_2860
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Alide2_2860
Lipid biosynthesis proteins [BR:adk01004]
 Fatty acid synthase
  Component type
   Alide2_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2981294..2981941
Genome map
AA seq 215 aa AA seqDB search
MFRRDFIAAGALALLGTAPALAQQSRKAAARAPVILVVGDSLSAEYGLPRGSGWVALLEK
RLAQEKIGATVVNASVSGDTTAGGRARLPALLRQHGPTHVVIELGANDALRGLPLTNTRD
NLAWMVEQSQAAGARVLLVGMQMPPNYGADYARRFAALFEAVAKERKVPLVPFLLHGIAD
VPDSTALFQPDRIHPRAEAHPRMLDNVWPQLRKLL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggcgtgactttatcgcggccggcgccctggccctgctcggcacggcgcctgcg
ctcgcgcagcagagccgcaaggccgccgccagggcccccgtgatcctggtggtgggcgac
tcgctcagcgccgaatacggcctgccgcgcggcagcggctgggtggcgctgctggagaag
cggctggcccaggaaaagatcggcgccacggtggtcaacgctagcgtgagcggcgacacc
acggccggcggccgcgcgcgattgcctgcgctgctcaggcagcacggccccacgcacgtg
gtgatcgagctgggcgccaacgacgcgctgcgcggcctgcccctgaccaacacccgggac
aacctggcatggatggtcgagcagtcacaggccgccggcgcgcgcgtgctgctggtgggc
atgcagatgccgcccaactacggtgccgactacgcacgccgcttcgccgccctgttcgag
gccgtggccaaggaacgcaaggtcccgctggtgccgttcctgctgcatggcattgccgac
gtgccggactccacggcgctgttccagcccgaccgcatccatccgcgcgccgaggcgcat
ccgcgcatgctcgacaatgtgtggccgcagctgcgcaagctgctgtga

DBGET integrated database retrieval system