KEGG   Alicycliphilus denitrificans K601: Alide2_2879Help
Entry
Alide2_2879       CDS       T01463                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide2_2879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_2879
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide2_2879
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide2_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2999673..3000881
Genome map
AA seq 402 aa AA seqDB search
MTASTDFAPMPDAQGFFGPYGGQLVPPHLKQAMDDINAAYAEITRRQDFQDELAQLFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVAVTRGAATLKEAVD
SAFEEYLTNPTDYLYAIGSVVGPHPFPMMVRDFQSIVGREAREQFQARHGRLPDYVAACV
GGGSNAMGIFTAFLNDTGVKLVGVEPSGEGTDKPGRHAATLSMGKPGEIHGMKCYVLEDA
AGQPAAVHSIASGLDYPGVGPQHSYLKDIGRVQYEAVTDKECLEAFMTLSRVEGIIPALE
SAHAVAWAMRVAPGLPKDQHILVNLSGRGDKDADYVAKVLGI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctctaccgacttcgcccccatgcccgacgcccagggcttctttggtccctat
ggcggccagctggtgccgccgcacctcaagcaggctatggacgacatcaacgccgcctat
gccgaaatcacccgccggcaggacttccaggacgagctggcgcagctgtttgccgactac
gtgggccggcccagcccgatcttccacgccaggcggctgtcggagcagctgggcggcgcg
cagatccacctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaaccactgc
ctgggcgaggccctgctggccaagttcatgggcaagaagaaggtgatcgccgagaccggc
gccggccagcacggcgtggcgctggccacggcctgcgcgctggtgggcattccgtgcgag
atccacatgggccaggtggacatcgagaaggagcaccccaacgtcaccaagatgcgcatc
ctgggctgcaagctcgtggcggtgacgcgcggcgcggccacgctgaaggaggccgtggac
agcgccttcgaggaatacctgaccaaccccaccgactacctctacgccatcggctcggtc
gtcggcccgcacccgttcccgatgatggtgcgcgacttccagagcatcgtcggccgcgag
gcgcgcgagcagttccaggccaggcatggccgcctgcccgactacgtggcggcctgcgtg
ggcggcggcagcaacgccatgggcatcttcacggccttcttgaacgataccggcgtgaag
ctggtgggcgtagagccctcgggcgaaggcacggacaagcccggccgccacgcggcgacg
ctgagcatgggcaagcccggcgagatccacggcatgaagtgctacgtgctggaagacgcc
gcaggccagccggccgcggtgcacagcatcgcctccggcctggactaccccggcgtgggc
ccgcagcacagctacctcaaggacatcggccgcgtgcagtacgaggcggtgaccgacaag
gaatgcctggaggcattcatgaccttgtcgcgcgtggagggcatcatccccgcgctggag
agcgcccacgccgtggcctgggccatgcgcgtggcgcccggcctgccgaaggaccagcac
atcctggtcaacctctcgggccgcggcgacaaggacgcggactacgtggccaaggtgctg
ggcatctga

DBGET integrated database retrieval system