KEGG   Alicycliphilus denitrificans K601: Alide2_2879Help
Entry
Alide2_2879       CDS       T01463                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide2_2879
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide2_2879
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide2_2879
Enzymes [BR:adk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide2_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2999673..3000881
Genome map
AA seq 402 aa AA seqDB search
MTASTDFAPMPDAQGFFGPYGGQLVPPHLKQAMDDINAAYAEITRRQDFQDELAQLFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVAVTRGAATLKEAVD
SAFEEYLTNPTDYLYAIGSVVGPHPFPMMVRDFQSIVGREAREQFQARHGRLPDYVAACV
GGGSNAMGIFTAFLNDTGVKLVGVEPSGEGTDKPGRHAATLSMGKPGEIHGMKCYVLEDA
AGQPAAVHSIASGLDYPGVGPQHSYLKDIGRVQYEAVTDKECLEAFMTLSRVEGIIPALE
SAHAVAWAMRVAPGLPKDQHILVNLSGRGDKDADYVAKVLGI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctctaccgacttcgcccccatgcccgacgcccagggcttctttggtccctat
ggcggccagctggtgccgccgcacctcaagcaggctatggacgacatcaacgccgcctat
gccgaaatcacccgccggcaggacttccaggacgagctggcgcagctgtttgccgactac
gtgggccggcccagcccgatcttccacgccaggcggctgtcggagcagctgggcggcgcg
cagatccacctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaaccactgc
ctgggcgaggccctgctggccaagttcatgggcaagaagaaggtgatcgccgagaccggc
gccggccagcacggcgtggcgctggccacggcctgcgcgctggtgggcattccgtgcgag
atccacatgggccaggtggacatcgagaaggagcaccccaacgtcaccaagatgcgcatc
ctgggctgcaagctcgtggcggtgacgcgcggcgcggccacgctgaaggaggccgtggac
agcgccttcgaggaatacctgaccaaccccaccgactacctctacgccatcggctcggtc
gtcggcccgcacccgttcccgatgatggtgcgcgacttccagagcatcgtcggccgcgag
gcgcgcgagcagttccaggccaggcatggccgcctgcccgactacgtggcggcctgcgtg
ggcggcggcagcaacgccatgggcatcttcacggccttcttgaacgataccggcgtgaag
ctggtgggcgtagagccctcgggcgaaggcacggacaagcccggccgccacgcggcgacg
ctgagcatgggcaagcccggcgagatccacggcatgaagtgctacgtgctggaagacgcc
gcaggccagccggccgcggtgcacagcatcgcctccggcctggactaccccggcgtgggc
ccgcagcacagctacctcaaggacatcggccgcgtgcagtacgaggcggtgaccgacaag
gaatgcctggaggcattcatgaccttgtcgcgcgtggagggcatcatccccgcgctggag
agcgcccacgccgtggcctgggccatgcgcgtggcgcccggcctgccgaaggaccagcac
atcctggtcaacctctcgggccgcggcgacaaggacgcggactacgtggccaaggtgctg
ggcatctga

DBGET integrated database retrieval system