KEGG   Alicycliphilus denitrificans K601: Alide2_2985Help
Entry
Alide2_2985       CDS       T01463                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Alide2_2985
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Alide2_2985
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Alide2_2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3116229..3116909
Genome map
AA seq 226 aa AA seqDB search
MAGWLLLDKSRCTTMKPSSFPRMLHMTGRALAFLLVLSHPMAFAGVPSAPPAKTAIAAAA
GEQAVFGCPAVLRHTFPRLQDDSPQSLCQYKGKVILVVNTASYCGFTYQYQGLEALFQKY
KDRGLVVLGFPSNDFFQEKNDNKEIADFCYNTYGVIFPMFARSAVRGSDANPLYKQLAQM
TGKAPGWNFNKYLIDRSGGAVTHYPSTVEPESTVFLGQLEKLLAKP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggatggttattactggacaagagtcgctgcacgacaatgaaaccgtcgtctttc
ccacgaatgctgcatatgactggtcgtgcattggcctttttgctcgttctttctcacccg
atggccttcgcgggtgtccccagtgccccgccggcaaagactgctatcgcagccgcagcg
ggagagcaggccgtgtttggttgtccggcggtgctcaggcacacgtttcccagattgcaa
gatgacagcccgcaatcgctgtgccagtacaagggtaaggtgatcctggtggtcaatacg
gccagctattgcgggttcacgtaccagtaccaggggctggaggcgctgtttcaaaagtac
aaagatcgcgggctggttgtcctgggcttcccgtcgaacgactttttccaggagaaaaac
gataacaaggaaatcgctgacttttgctacaacacctatggcgtgatcttcccgatgttc
gcgcgttctgccgtgcggggatccgatgccaacccactctataagcagctggcgcagatg
actggcaaggcgccggggtggaacttcaacaaatacctcattgaccgatcggggggtgcg
gtcactcactacccgagcacggtcgagccagaaagcaccgtgtttctggggcagctggag
aaactgcttgccaaaccctga

DBGET integrated database retrieval system