KEGG   Alicycliphilus denitrificans K601: Alide2_3025Help
Entry
Alide2_3025       CDS       T01463                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide2_3025
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide2_3025
  Amino acid metabolism
   00310 Lysine degradation
    Alide2_3025
Enzymes [BR:adk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Alide2_3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3161281..3162537)
Genome map
AA seq 418 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAEL
LVGDGGTVVSDQPIARIDTEGKAGAAAPAAAAPAAAAPAAAAAAPAAAGGGKGDVAMPAA
AKILAENNLSAAQVAGSGKDGRVTKGDALAAVAGGVKSTAAVIPTGVPAKALPQVAAPSS
ALDLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMELRKKFQDAFTKE
HGVKLGFMSFFVKAAVHALKKYPVLNASVDGTDIVYHGYFDIGIAVGSPRGLVVPILRNA
DQMSFADIEKKIAEFGKKAGEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAILG
VHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtagaagtcaaggttccccagctgtccgagtccgtggccgaggccacgctg
ctgcagtggaagaagaagcccggcgaggccgtcgcccaggacgagatcctgatcgagatc
gagaccgacaaggtggtgctggaagtgccggccccgtccgccggcgtgctggccgagctg
ctggtgggtgatggcggcacggtcgtgtccgaccagcccatcgccaggatcgacaccgag
ggcaaggccggcgccgccgcgcccgccgctgcagcgcctgccgcagcggcccccgcggcg
gctgccgccgcaccggccgccgccggcggcggcaagggcgacgtggccatgcccgccgcc
gccaagatcctggccgagaacaacctgtcggccgctcaggtggccggcagcggcaaggat
ggccgcgtcaccaagggcgacgccctggcggccgtggccggtggcgtcaagtccaccgcc
gccgtgatccccaccggcgtgcccgccaaggcgctgccccaggtggcggctccgtcatcg
gccctggacctgggcgagcgccccgagcagcgcgtacccatgagccgcctgcgcgcccgc
gtggccgagcgcctgctgcagtcgcaatccaccaacgccatcctgaccaccttcaacgag
gtcaacatggccccggtgatggagctgcgcaagaagttccaggatgcgttcaccaaggaa
cacggcgtgaagctcggcttcatgtccttcttcgtcaaggctgcggtgcacgcgctcaag
aagtacccggtgctcaacgccagcgtggacggcaccgacatcgtctaccacggctacttc
gacatcggcatcgccgtcggttcgccgcgcggcctggtggtgcccatcctgcgcaacgcc
gaccagatgagcttcgccgacatcgagaagaagatcgccgagttcggcaagaaggccggc
gaaggcaagctgggcatcgaggagatgaccggcggcacgttctcgatcagcaacggcggc
accttcggctcgatgatgtccacccccatcatcaacccgccgcagtcggccatcctgggc
gtgcacgccaccaaggaccgcgccgtggtcgagaacggccaggtcgtggtgcgtccgatg
aactacctggccatgtcctacgaccaccgcatcatcgacggccgcgaggccgtcctgggc
ctggtggccatgaaggacgcgctggaggatccctcgcgcctgctgttcgacctgtga

DBGET integrated database retrieval system