KEGG   Alicycliphilus denitrificans K601: Alide2_3234Help
Entry
Alide2_3234       CDS       T01463                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Alide2_3234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3370600..3371310
Genome map
AA seq 236 aa AA seqDB search
MNMPLNTSADIHDPVEQARYNMVEQQIRPWNVLDAGVLELLSVVRREDFVPPAYQGAAFT
DTRIPLNPDAQEAERLGQVMLEPRVDARMLHDLQVQPTDRVLEIGAGSGYMAALLAARAE
RVVSLEIDPDLAEFARENLRGAGVENAQVRQADGALDPIPDGPFDVIVLSGSVAEVPQKL
LALLRDGGRLGAYVGHQPMMRATFVRRSGERFETSQPWDVVVPRLRNFPEPSPFKF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcccctgaacacgtccgccgacatccacgatcccgtcgagcaggcccgctac
aacatggtggagcagcagatccgtccgtggaacgtgctcgacgcgggcgtgctggagctg
ctgtccgtcgtgcgccgtgaagacttcgtcccgcccgcctaccagggcgcggccttcacc
gacacgcggatccccctgaaccccgacgcgcaggaggccgagcgcctgggccaggtgatg
ctggagccgcgcgtggacgcgcgcatgctgcacgacctgcaggtccagcccaccgaccgc
gtgctggagatcggcgccggctcgggctacatggccgccctgctggccgcccgcgccgag
cgcgtggtgtcgctggagatcgaccccgacctggccgaattcgcccgcgagaacctgcgc
ggcgccggcgtggaaaacgcccaggtgcgccaggccgacggcgcgctcgatcccattccc
gacggcccgttcgacgtgatcgtgctcagcggctccgtggccgaggtgccgcagaagctg
ctggcgctgctgcgcgacggcggccgcctgggcgcctacgtgggccaccagcccatgatg
cgggccaccttcgtgcgccgcagcggcgagcgcttcgagaccagccagccctgggacgtg
gtcgtgccgcgcctgcgcaacttccccgagccctcgcccttcaagttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system