KEGG   Alicycliphilus denitrificans K601: Alide2_3345Help
Entry
Alide2_3345       CDS       T01463                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
adk  Alicycliphilus denitrificans K601
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3485541..3486380
Genome map
AA seq 279 aa AA seqDB search
MMATTESARRSHRFASTVLCAVLAAAAAAAQAASPDETRLLTALRKAHPGTEFSEVSRTE
VSGLYEVWMNGNVAYVMSTNPRYFIFGRLFDTQAMRDITGPRIAQRSSQSSQDGRAQTEA
VSAAPVPVDQLPLADAIKTVRGNGQRKLAVFSDPNCVYCKQLEPELAGLDNVTIYTFLVP
FQGEARPVAIWCAADRERAWRQWMLQADASLMQPGAQCDHPIARNLELARRLRVQGTPTM
IWADGSRTDGYVGRSVLEARFAEVGKVAVAQPVKTEKRP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaactactgaatccgcgcgccggagccaccgcttcgcttcgacagtgctctgc
gctgtgctggcggctgcggccgccgccgcccaagccgcgtctccagacgagacccggctc
ctgaccgctttgcgcaaggcccatccgggcacggagttctccgaggtgtcgcgcaccgag
gtctcgggcctctacgaggtctggatgaacggcaacgtcgcctatgtcatgtcgacgaat
ccacgctatttcatcttcgggcggctgttcgacacccaggccatgcgtgacatcaccggc
ccgaggatcgcgcagcgctccagccagtccagccaggatggacgggcgcagacggaagcc
gtctccgccgcgccggtgccagtcgatcagttgccgctggccgatgcgatcaagacggtg
cgcggcaacggccagcgcaagctcgccgtgttcagcgacccgaactgcgtctattgcaag
cagctcgaacccgagctcgcaggcctggacaacgtcacgatctacacctttctcgtccca
ttccagggcgaggcccggccggtcgccatctggtgcgcagccgaccgcgaacgcgcctgg
cgccaatggatgctgcaggcggatgccagcctgatgcagccgggcgcgcagtgcgatcac
ccgattgcgcgcaacctcgagctggcgcgccggctccgcgtgcagggaacgccgaccatg
atctgggcagacggcagccgcaccgacggctatgtcgggcgctccgtgctcgaagccagg
ttcgcggaggtcggcaaggtggccgtggcccagccggtcaagacggagaagcggccatga

DBGET integrated database retrieval system