KEGG   Alicycliphilus denitrificans K601: Alide2_3616Help
Entry
Alide2_3616       CDS       T01463                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Alide2_3616
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Alide2_3616
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Alide2_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3755835..3756617
Genome map
AA seq 260 aa AA seqDB search
MLNGKTALVTGSTSGIGLGIAKALARQGANIVLNGFGDVDGPRAEVLAAGQAAGARVAYH
GADMSRPADIEDMLKYAATQFGRVDILVNNAGIQHVASVQDFPPERWDAIIAINLTSAFH
TTRLALPGMLANDWGRIINVASVHGLVASAQKSAYVAAKHGIVGLTKVTALENATTGVTC
NAICPGWVLTPLVQKQVDAKAAALGISNDEAKKVLLGEKEPSMQFTTPEELGELAVFFCS
PAANNVRGVAWNMDGGWAAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacggcaaaaccgccctcgtcaccggctccaccagcggcatcggccttgggatc
gccaaagccctggcgcgccagggggcaaacatcgtgctcaacggcttcggcgacgtggac
gggccgcgcgccgaggtgctggccgctggccaagccgcgggggcccgcgtggcctaccac
ggcgcggacatgagccgccccgccgacatcgaggacatgctcaagtacgccgccacccag
ttcggccgcgtggacatcctggtgaacaacgccggcatccagcacgtggccagcgtgcag
gacttcccgcccgagcgttgggacgccatcatcgccatcaacctcacgagcgccttccac
accacgcgcctggccctgccgggcatgctggcgaacgactgggggcgcatcatcaacgtg
gcctcggtgcacggcctggtggcctcggcgcagaagtcggcctacgtggcggccaagcac
ggcatcgtcggcctgaccaaggtgacggcgctggagaacgccaccacgggcgtgacctgc
aacgccatctgcccgggctgggtgctgaccccgctggtgcaaaagcaggtggacgccaag
gccgcggcgctgggcatctcgaacgacgaggccaagaaggtgctgctgggcgagaaggag
ccctccatgcagttcaccacgcccgaggagctgggcgagctggcggtattcttctgctcg
cccgccgccaacaacgtgcgcggcgtggcctggaacatggatggcggctgggctgcgcag
taa

DBGET integrated database retrieval system