KEGG   Alicycliphilus denitrificans K601: Alide2_3751Help
Entry
Alide2_3751       CDS       T01463                                 

Definition
acetate/CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:adk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:adk00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adk00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:adk00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:adk00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3896246..3898243)
Genome map
AA seq 665 aa AA seqDB search
MSASPSAIESVLIENRVFPPPEGLVKTARISGMAGYEALCAEADKDFEGFWARLARENLQ
WTRPFTKTLDESNAPFYQWFADGELNASANCLDRHMGTPVESKTAIIFEADDGAVTKVTY
KELLARVAQFANALKAQGVKKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKA
VQERIIDAGAVAVITANYQLRGGKELPLKAIVDEGIAMGGCESIKSVLVYERTPTAWNRV
DGRDKSFAEALAGQSTECVPVAVEAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKLTMD
WTFDLRPDDVFWCTADIGWVTGHTYIAYGPLAAGGTQVMFEGIPTYPNAGRFWQMIERHK
VSIFYTAPTAIRSLIKAADSDEKVHPKNWDLSSLRILGSVGEPINPEAWMWYYKNVGGER
CPIVDTWWQTENGGHLITPLPGATPLVPGSCTLPLPGIAAAIVDETGKDVPNGSGGMLVI
KRPWPSMIRTIWNDPERFKKSYFPEEMGGKIYLAGDGAVRDAKTAYFRVTGRIDDVLNVS
GHRMGTMEIESALVAKSDLVAEAAVVGRPDDLTGEAICAFVVLKRARPTGEEAKQIAAEL
RNWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILDQ
LAQNN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttccccgtccgcgatcgagtccgtcctgatcgaaaaccgtgtgtttcccccg
cccgagggcctggtgaagacggcacgcatctccggcatggccggctacgaggcgctgtgc
gccgaggccgacaaggacttcgagggcttctgggcccgccttgcgcgcgagaacctgcag
tggaccaggcccttcacgaagacgctggacgagtccaacgcgccgttctaccagtggttc
gccgacggcgagctcaacgccagcgccaactgcctggaccggcacatgggcacgccggtc
gagagcaagaccgccatcatcttcgaggctgacgacggcgccgtcaccaaggtcacctac
aaagagctgctcgcccgcgtggcccagttcgccaatgcgctcaaggcgcagggcgtgaag
aagggcgaccgcgtcctgatctacatgcccatgaccatcgagggcgtggtggccatgcag
gcctgcgcgcgcatcggcgccacgcacagcgtggtgttcggcggcttctcggccaaggca
gtgcaggagcgcatcatcgacgccggcgccgtggccgtgatcaccgccaactaccagctg
cgcggcggcaaggaactgccgctcaaggccatcgtggacgagggcatcgccatgggcggc
tgcgagtccatcaagtcggtgctggtctacgagcgcacccccaccgcctggaaccgcgtg
gacgggcgcgacaagagctttgccgaggccctcgcgggccagagcaccgaatgcgtcccg
gtggccgtggaggcggagcacccgctgttcatcctctacacctcgggctccacgggcaag
cccaagggcgtgcagcattccacgggcggctacctgctgtgggccaagctgacgatggac
tggaccttcgacctgcgccccgacgacgtgttctggtgcacggccgacatcggctgggtc
acgggccacacctacatcgcctacgggccgctggccgcgggcggcacccaggtgatgttc
gagggcattcccacctaccccaacgccgggcgcttctggcagatgatcgagcgccacaag
gtcagcatcttctataccgcgccaacggccatccgctcgctcatcaaggcggctgattcc
gacgagaaggtgcacccgaagaactgggacctctccagcctgcgcatcctgggcagcgtg
ggcgagcccatcaaccccgaagcctggatgtggtactacaaaaacgtaggcggcgagcgc
tgccccatcgtggacacctggtggcagacggagaacggcggccacctgatcaccccgctg
ccgggcgccacgcccctggtgccgggctcgtgcacgctgccgctgcccggcatcgccgcc
gccatcgtcgatgagaccggcaaggacgtgcccaacggctcgggcggcatgctggtcatc
aagcggccctggccttcgatgatccgcaccatctggaacgaccccgagcgcttcaagaag
tcgtacttccccgaggagatgggcggcaagatctaccttgcgggcgacggcgccgtgcgc
gacgccaagactgcctacttccgcgtcaccggccgcatcgacgacgtgctcaacgtctcg
ggccaccgcatgggaacgatggaaatcgaatccgccctggtcgccaagtccgacctggtg
gccgaggccgccgtggtgggccgccccgacgacctcacgggcgaggccatctgcgccttc
gtcgtcctcaagcgcgcccgccccacgggcgaggaggccaagcagatcgccgccgaactg
cgcaactgggtggccaaggaaatcggccccatcgccaagcccaaggacatccgcttcggc
gacaacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgcagcctggcc
aagggcgaggccatcacccaggacaccagcacgctggagaatccggcgatcctcgatcaa
ttggcgcagaacaattga

DBGET integrated database retrieval system