KEGG   Alicycliphilus denitrificans K601: Alide2_3892Help
Entry
Alide2_3892       CDS       T01463                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:adk00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:adk00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4052574..4053536
Genome map
AA seq 320 aa AA seqDB search
MLYKRNPQLNKNGELIHLLSIEGLPREIVTHILDTAANFTSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFDIAAKRLSADVFNLDIARSSTAKGETLLDTIDNLTAMAADIFVVRHS
ESGAPYLIAQHVGPHVHVVNAGDGRHSHPTQGLLDMYTIRHYKKDFSNLTVAIVGDVLHS
RVARSDIHGLTTLGAAEVRVVGPRTLVPADMAQMGVRVFHNLEEGIKDCDVVIMLRLQNE
RMSGALLPSSQEYFKSFGLTPEKLLHAKPDAIVMHPGPINRGVEIDSAVVDGPQAVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtacaagcgcaacccccaactcaacaagaacggcgagctgatccacctgctctcg
atcgagggcctgcccagggagatcgtcacgcacatcctggacacggccgccaacttcacc
agcgtcaacgaccgcgaggtcaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacgcgcacgcgcaccaccttcgacatcgcggccaagcgcctg
tcggccgacgtgttcaacctggacatcgcgcgctcctcgacggccaagggcgagaccctg
ctggacaccatcgacaacctgaccgccatggcggccgacatcttcgtcgtgcgccacagc
gagtcgggcgcgccctacctcatcgcccagcacgtgggcccgcacgtgcacgtggtcaac
gccggcgacggccgccactcgcaccccacgcagggcctgctggatatgtacaccatccgc
cactacaagaaggacttctccaacctcacggtggccatcgtgggcgatgtgctgcactcg
cgcgtggcgcgctcggacatccacggcctgaccacgctgggcgcggccgaggtgcgcgtg
gtgggcccgcgcacgctggtgccggccgacatggcgcagatgggcgtgcgcgtgttccac
aacctggaggagggcatcaaggactgcgacgtggtcatcatgctgcgcctgcagaacgag
cgcatgagcggcgcgctgctgccgtcgagccaggaatacttcaagagcttcggcctcacg
cccgagaagctgctgcacgccaagcccgacgccatcgtcatgcacccgggcccgatcaac
cgcggcgtggagatcgactccgccgtggtggacggcccgcaggccgtgatcctgccgcag
gtcaccttcggcatcgctgtgcgcatggcggtcatgtccatcgtggcggggaacgaggct
tga

DBGET integrated database retrieval system