KEGG   Alicycliphilus denitrificans K601: Alide2_4000Help
Entry
Alide2_4000       CDS       T01463                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00230  Purine metabolism
adk01100  Metabolic pathways
Module
adk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Alide2_4000
Enzymes [BR:adk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Alide2_4000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 ABC_tran RsgA_GTPase MMR_HSR1 AAA_22 Methyltransf_12 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEB86319
UniProt: F4G4A3
Position
4167905..4168525
Genome map
AA seq 206 aa AA seqDB search
MDYPGNLFVVSAPSGAGKSSLVKALLELDSHVQPSVSHTTRAPRGQEKHGREYFFVSEQE
FDAMVAANGFVEWANVHGRRYGTSRKAIEERVALGADVVLEIDYQGALQIKQAFVNAVLI
FILPPSWEELRSRLERRGEDAADVIDLRLKNAEEEMAQAGKFDFVIINEVFERALFDLKT
IVHAQRLKYAAQRRARADTFESLNIP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggattaccccggaaatttgttcgtagtctctgctcccagcggggcgggcaagtcgagc
ctggtgaaggcgcttctggagctggactcgcacgtgcagccctcggtgtcgcacaccacg
cgtgcgccccgtggccaggaaaagcacgggcgcgagtatttcttcgtctccgagcaggag
ttcgacgccatggtggcggccaacggcttcgtggagtgggcgaacgtgcacgggcggcgc
tacggcacctcgcgcaaggccatcgaggagcgcgtggccctgggcgcggacgtggtgctg
gagatcgactaccagggtgcgctgcagatcaagcaggccttcgtcaacgcggtgctgatc
ttcatcctgccgcccagctgggaggagttgcgctcgcgcctggagcggcgcggcgaggat
gccgccgacgtgatcgatctgcggctgaagaacgctgaggaggagatggcgcaggccggc
aaattcgacttcgttataatcaacgaggtgtttgaacgagcgcttttcgatctgaaaacc
attgttcacgcccagcgtctcaagtacgccgcccagcgccgcgcccgggccgacaccttt
gaatcgctcaacatcccctga

DBGET integrated database retrieval system