KEGG   Alicycliphilus denitrificans K601: Alide2_4064Help
Entry
Alide2_4064       CDS       T01463                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Alide2_4064
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Alide2_4064
Enzymes [BR:adk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Alide2_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4237353..4238858)
Genome map
AA seq 501 aa AA seqDB search
MSAPQALASVDAAVAWLRARVTGTLQTDSRLVAPGDAFIAWPGAATDGRAHVGDAMARGA
VACLVEQEDVEPFGLAGEHIAALPGLKAATGLIAAQWFGRPSERLQVLAVTGTNGKTSTA
WWLADALNGLSKKELPALAGCALVGTLGIGVPPGLSSTGMTTPDPVRLQRAFAQFAQEGL
GACAIEASSIGLAEQRLAGTQISVALFTNLTQDHLDYHSDMAAYWQAKRVLFDWPGLRAA
VVNIDDAHGARLHAELQGGGLDLWSVSIQGPARLQARDIVHRGAGLAFTVAESAQALPLQ
TRLIGLYNVSNLLGVIAGMRALGVPLAQALDACARLAPVPGRMEQLAFAGQPLVAVDYAH
TPDALHQALAALRPMAAQRGGRLWCVFGCGGNRDAGKRPLMGAVAQREADRVIVTSDNPR
GEDPRAIIHQILLGTIAGTSVRAEEDRAAAICLAVAEAEAADVVLIAGKGHEDYQETAGQ
RQPFSDMAHARAALARRGAAA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccgcaggcactggcatccgtggacgcggccgtggcctggctgcgcgcgcgc
gttacgggcacgctgcagaccgacagccggctcgtcgcgcccggcgacgccttcatcgcc
tggcccggcgcggccaccgacgggcgtgcccacgtgggcgatgccatggcgcgtggcgcc
gtggcctgcctggtggagcaggaggacgtggagcctttcggcctcgcgggcgagcacatc
gcggcgcttcccggcctcaaggcagccaccgggctcatcgcggcccaatggttcggccgg
cccagcgaacgcctgcaggtgctggccgtgaccggcaccaatggcaagaccagcaccgcc
tggtggctcgccgatgcgctcaacggactatcgaaaaaggagctgcccgcgcttgcgggg
tgcgccctggtgggcactttggggataggcgtaccgcccggactgagcagcaccggcatg
accacgcccgaccccgtgcgcctgcagcgtgccttcgcgcagttcgctcaagaggggctg
ggggcctgcgccatcgaggcctcgtccatcggcctggccgagcagcgcctggccggcacg
cagataagcgtggcgctgttcaccaacctcacccaggaccacctggactaccactccgac
atggccgcctactggcaggccaagcgcgtgctgttcgactggcccggcttgcgcgcggcc
gtggtcaacatcgacgacgcgcatggcgcgcggctccatgccgaactgcagggaggcggt
ctggacctgtggagcgtctccatccagggcccggcgcggctgcaggcgcgggatatcgtg
caccgcggcgcgggcctggccttcaccgtggccgagagcgcgcaggccttgccgctgcag
acgcggctcatcggcctgtacaacgtgtccaacctgctgggtgtgattgccggcatgcgc
gccctgggcgtgccgttggcgcaggcgctcgacgcctgtgcgcggctcgcgcccgtgccc
ggccgcatggagcaactggccttcgcgggccagcccctggtggccgtggactatgctcac
acgcccgacgcgctgcaccaggcgctggcggcgctgcggcccatggcggcgcagcgcggc
ggccggctgtggtgcgtgttcggctgcggcggcaaccgcgacgcgggcaagcgcccgctg
atgggcgccgtggcgcagcgcgaggcggaccgcgtcatcgtcaccagcgacaacccgcgc
ggcgaggacccgcgtgccatcatccaccagatcctgctgggcacgatcgccggtaccagc
gtgcgcgccgaggaagaccgcgccgccgctatttgcctggccgtggccgaggccgaagcc
gccgacgtggtgctgatcgccggcaagggccacgaggactaccaggagacggccggccag
cgccagccgttttccgacatggcgcatgcgcgcgccgcgctcgcgcgccgaggagccgca
gcatga

DBGET integrated database retrieval system