KEGG   Alicycliphilus denitrificans K601: Alide2_4317Help
Entry
Alide2_4317       CDS       T01463                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Alide2_4317
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Alide2_4317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4517418..4517810)
Genome map
AA seq 130 aa AA seqDB search
MFIIRTSLLLCCLLGGALINRYALAADPSSEALRSLAVQQCAQCHTFDRGVGPGYGPNLF
GIVGRKAGSAQSFTYSPGFLAAMSEKTWDEKLLDRFLGDTQVVAPGTGMTYFQDDPKIRK
KLIQFLRSLQ
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgttcattattagaacatcgttattactatgttgcctcctaggtggggctttgatcaat
cgttacgcactcgcggcagacccctccagcgaggccctcagatcacttgccgtgcagcag
tgtgcgcaatgccacaccttcgatcgaggcgtgggtccgggttacgggccgaacttgttc
ggaattgttggccgcaaagcgggaagcgctcagagtttcacgtactcgccaggattcctg
gccgcgatgtccgaaaagacatgggacgaaaagctcctcgataggtttctcggagacaca
caagtggtggcacctggcacggggatgacctatttccaggatgatccgaagattcgtaag
aagttgattcaatttctgcgctcgctgcagtga

DBGET integrated database retrieval system