KEGG   Alicycliphilus denitrificans K601: Alide2_4385Help
Entry
Alide2_4385       CDS       T01463                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide2_4385
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide2_4385
Enzymes [BR:adk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Alide2_4385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4586264..4587064)
Genome map
AA seq 266 aa AA seqDB search
MSDILSKICGVKAEEVAAAKKRMPLADMRRDAESRVLTRDFVGALRAKIGAGQAGVIAEI
KKASPSKGVIRADFIPADIAQSYAEGDGKVSAACLSVLTDRQFFQGQPDYLKQARASCTL
PVLRKDFMVDPYQIYESRAMGADCVLLIAACLDDAQMADMEAIAHGLDMAVLVEVHDGAE
LERALRLKTPLVGINNRNLRTFEVSLQTTLDLKKHVPADRLLVAESGILAPDDVRTLRDA
GVNAFLVGEAFMRAPDPGLALARLFA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgagcaaaatctgcggcgtgaaggccgaggaagtggccgccgccaag
aagcgcatgccgctggccgacatgcgtcgcgacgccgagagccgcgtgctcacgcgcgac
ttcgtgggcgcgctgcgcgccaagatcggcgcgggccaggccggcgtgatcgccgagatc
aagaaggccagccccagcaagggcgtgatccgcgccgacttcatccccgccgacatcgcg
cagagctatgccgagggcgacggtaaggtgagcgccgcgtgcctgtcggtgctcaccgac
cgccagttcttccagggccagcccgactacctcaagcaggcgcgcgcgagctgcactttg
cccgtgctgcgcaaggacttcatggtcgatccgtaccagatctacgagtcgcgcgcgatg
ggcgcggactgcgtgctgctgatcgctgcgtgcctggacgacgcgcagatggccgacatg
gaggccatcgcccatggcctggacatggccgtgctcgtggaggtgcacgacggcgcggag
ctggagcgcgccttgaggctcaagaccccgctggtcggcatcaacaaccgcaacctgcgc
accttcgaggtatcgctgcagaccacgctggacttgaaaaagcacgtgccggccgaccgc
ctgctggtggccgagtcgggcatcctcgcgcccgacgacgtcaggacgctgcgcgatgcg
ggtgtgaacgccttcctcgtcggcgaggctttcatgcgcgcgcccgatcccgggctggcg
ctggcccggctgtttgcatga

DBGET integrated database retrieval system