KEGG   Alicycliphilus denitrificans K601: Alide2_4446Help
Entry
Alide2_4446       CDS       T01463                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide2_4446
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide2_4446
   00630 Glyoxylate and dicarboxylate metabolism
    Alide2_4446
Enzymes [BR:adk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Alide2_4446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4653626..4655824
Genome map
AA seq 732 aa AA seqDB search
MTARTQVHGLQVANELHAFINQQVLPGTGVDPAAFWKGFDAIVADLAPKNAALLAERDRL
QKELDTWHKANPGPITDMVGYRAFLSRIGYLVEPPKGAKASTANVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPVRGAKVIEFARNFLDQAA
PLASGSHKDATAYRVEGGKLAVALKDGGATGLKDAAQFVGYQGDAAAPSSVLLVNNGLHI
DIRIDRGTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVLGYGNWLGILKGTL
TETFEKGGKAMTRGLNPDREYTGADGRPVKLHGRSLMFVRNVGHLMTNPAILWGAEGKEI
PEGILDAVVTTAIALHDLKGLGTPGIRNSRTGSVYIVKPKMHGPAEVAFANELFGRVELL
LGLPDSTVKLGIMDEERRTSVNLQACIAAASTRVAFINTGFLDRTGDEMHTAMHAGPMIR
KGDMKTSAWIQAYEKNNVLVGLSMGLRGKAQIGKGMWAMPDLMKAMLEQKIAHPKAGANT
AWVPSPTGATLHALHYHQVKVSDIQQELEKIDALAERDNLLAGLLTVPVTASPNWSEQEK
QQELDNNIQGILGYVVRWVDQGVGCSKVPDINDVGLMEDRATLRISSQHVANWLLHGIVT
EGQVRATFERMAAKVDQQNGGDPLYQRMHGRFGESMAYQAACDLVFKGVEQPSGYTEPLL
HAWRLKVKAAAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtacccaagtccatggcctgcaggtggccaacgaactgcacgccttcatc
aaccagcaggtgctgcccggcactggcgtcgatcctgcggccttctggaagggttttgac
gccatcgtcgccgatctcgcgcccaagaacgccgccctgctggccgagcgcgaccgcctg
cagaaggaactggacacctggcacaaggccaaccccggccccatcacggacatggtgggc
taccgcgccttcctctcgcgcatcggctacctcgtcgagccgcccaagggcgccaaggcc
agcacggcgaacgtggatgccgagctggccatccaggccggcccgcagctcgtggtgccc
atcctgaacgcgcgctatgcgctcaacgcggccaatgcgcgctggggctcgctctacgac
gcgctctacggcaccgacgtgatcggcgaggagggcggcgccgagaagggcaagggctac
aaccccgtgcgcggcgcgaaagtgattgaattcgcgcgcaacttcctggaccaggccgcg
ccgctggcctccggctcgcacaaggacgccacggcctacagggtggagggcggcaagctg
gccgtcgcgctcaaggatggtggcgccaccggcctgaaggacgccgcgcagttcgtaggc
taccaaggtgacgcggcagcgccctcgtccgtgctgctggtgaacaacggcctgcacatc
gacatccgcatcgaccgcggcacccccatcggcaagggcgatgccgccggcgtggccgac
gtggtggtggaggcggccctgtccaccatcctcgacctggaggactccgtcgccgccgtg
gatgccgaggacaaggtgctgggctacggcaactggctgggcatcctcaagggcacgctg
accgagaccttcgagaaaggcggcaaagccatgacgcgcggtctgaaccccgaccgcgag
tacacgggcgccgacggcaggccggtgaaactgcacggccgctcgctgatgttcgtgcgc
aacgtgggccacctgatgaccaaccccgccatcctgtggggcgccgagggcaaggagatc
cccgagggcatcctggacgccgtggtcaccacggccatcgcgctgcacgacctcaagggc
ctgggcacgccgggcatccgaaacagccgtacgggcagcgtctacatcgtcaagcccaag
atgcacggcccggccgaggtggccttcgccaacgagctgttcggccgcgtcgagctgctg
ctgggcctgcccgacagcaccgtcaagctcggcatcatggacgaggagcgccgcacctcg
gtcaacctccaggcctgcatcgccgccgccagcacccgcgtggccttcatcaacacgggc
ttcctcgaccgcacgggcgacgaaatgcacaccgccatgcacgccggccccatgatccgc
aagggcgacatgaagaccagcgcctggatccaggcctatgagaagaacaacgtgctcgtg
ggcctgtcgatgggcctgcgcggcaaggcccagatcggcaagggcatgtgggccatgccg
gacctgatgaaggccatgctggagcagaagatcgcccatcccaaggcgggcgccaacacc
gcctgggtgcccagccccacgggcgccacgctgcacgccctgcactaccaccaggtgaag
gtgagcgacatccagcaggagttggagaagatcgacgccctggccgaacgcgacaacctg
ctggccggcctgctcaccgtgcccgtgaccgcctccccgaactggagcgagcaggaaaag
cagcaggagctggacaacaacatccaaggcatcctgggctacgtggtacgctgggtggac
cagggcgtgggctgctccaaggtgcccgacatcaacgacgtgggcctgatggaagaccgc
gccaccctgcgcatctccagccagcacgtcgccaactggctcctgcacggcatcgtgacc
gaaggccaggtgcgcgccaccttcgagcgcatggccgccaaggtggaccagcaaaatggc
ggcgacccgctgtaccagcgcatgcacgggcgcttcggcgaatccatggcctaccaggcg
gcctgcgacctggtgttcaagggcgtcgagcagcccagcggctacaccgagccgctgctg
catgcctggcgcctgaaggtcaaggcggctgccgcctga

DBGET integrated database retrieval system