KEGG   Alicycliphilus denitrificans K601: Alide2_4547Help
Entry
Alide2_4547       CDS       T01463                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00010  Glycolysis / Gluconeogenesis
adk00620  Pyruvate metabolism
adk00640  Propanoate metabolism
adk00680  Methane metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide2_4547
   00620 Pyruvate metabolism
    Alide2_4547
   00640 Propanoate metabolism
    Alide2_4547
  Energy metabolism
   00680 Methane metabolism
    Alide2_4547
Enzymes [BR:adk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Alide2_4547
Lipid biosynthesis proteins [BR:adk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Alide2_4547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEB86850
UniProt: F4GA47
Position
complement(4766261..4768243)
Genome map
AA seq 660 aa AA seqDB search
MHVDTPNPSPDAVWRPDRGTVENANLTRFMRALGVDGFEQLNERAGADPGWFHDALIRFL
DYRFEQPYEKVLDLGEGLPFARWCVGGTTNVVLNCIDRWRGTARYTRTALVWEGEDGAVQ
AWSLADLDREACRLGWGLRRLGLGRGDVVGMYLPNLPQAAVAMLAVAKIGGIVLPMFSGF
GADAIAQRLGDGQAKALITVDGSLRRGKPVGAKAVADEALPQCPGVRHVVVLDHLATGHG
WREGRDHWWHELVAGAPDDCAAVPTEAMPADAPFLLMFTSGTTGKPKGVVHSHCGFPVKT
ALDLSICMDLKPEDRFLWMSDMGWLVGPILVFGGLLVGSTVVLAEGAPNYPQPDRLWRLI
ERHRVSYLGLAPTVARLSMSIADDALGALDLASLRVIVSTGEPWTPEAWRWTFERVGRCR
VPLLNYSGGTEVGGILTGTVIHPLKPCAFAGPVPGTGADVVDAEGASAGPGVMGELVMRS
PSIGLTRGLWHDRERYLQSYWSRLPGMWVHGDFASRDADGMWYVHGRSDDTLKIAGKRTG
PSEIEALLMDTGLLQDAAAIGVPDPVKGTAVVCLCVPRSGIEKAGAAEALSAAVAAGLGG
AFRPARVVFVDDLPRTRNMKTMRRVIRAAWLGDDPGDLSTLVNPESVQAIRAALAAQGPA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcgacacccccaatccttcgcctgatgccgtgtggcggccggaccgcggcacg
gtggaaaacgccaacctcacgcgtttcatgcgggcgcttggcgtcgatggtttcgagcag
ctcaacgagcgcgccggcgcggacccgggctggttccacgatgcgctgatccgctttctg
gactaccggttcgagcagccctacgagaaggtgctcgacctgggcgaggggctgcccttc
gcgcgctggtgcgtgggcgggaccaccaacgtggtgctcaactgcatcgaccggtggcgc
ggcacggcgcgctacacgcggaccgcgctggtctgggaaggcgaagacggcgcggtgcag
gcctggagccttgcggaccttgaccgcgaggcctgccggctcggctgggggctgcgccgg
ctggggttgggccggggcgatgtggtgggcatgtacctgcccaacctgccgcaggccgcc
gtcgccatgctggccgtcgccaagatcggcggcatcgtgcttcccatgttctcggggttc
ggcgccgacgccatcgcgcagcgcctgggtgacgggcaggccaaggcgctgatcacggtc
gatggctccctgcggcgcggcaagccggtcggcgccaaggcggtggccgacgaggcgctg
ccgcagtgccccggcgtgcgccacgtcgtggtcctggatcatctggccaccgggcatggc
tggcgcgaggggcgcgaccactggtggcacgaactcgtcgccggcgcgccggacgactgc
gcggccgtgcccacggaagccatgccggccgacgcacccttcctgctgatgttcacgtcg
gggaccaccggcaagcccaagggcgtggtgcactcgcactgcggcttcccggtcaagacg
gcgctggatctttccatctgcatggacctcaagcccgaggaccgtttcctgtggatgtcg
gacatgggctggctggtggggccgatcctggtgttcggcggcttgctcgtgggatcgacg
gtggtgctggcggaaggcgcgcccaactatccgcagccggaccgcctgtggcgcctcatc
gaacgccaccgcgtcagctatctgggcctcgcgcccacggtggcgcgtctttcgatgtcg
atcgcggacgacgccctcggagccctcgacctcgcatctctgcgcgtcatcgtctccacc
ggcgagccctggacgcccgaggcctggcgctggaccttcgagcgcgtgggccggtgccgg
gtcccgctcctgaactattccggcggcaccgaggtgggcggcatcctgacgggcacggtg
atccacccgctcaagccctgcgcgttcgccggccccgtgccggggacgggtgccgacgtg
gtcgatgccgaaggggccagcgccgggccgggcgtgatgggcgagctggtgatgcgcagc
cccagcatcgggctcacgcgcgggctgtggcatgaccgggagcgctaccttcaaagctac
tggtcccgcctgccgggcatgtgggtgcatggggacttcgccagccgcgacgccgatggc
atgtggtacgtgcatggccggtccgacgacacgctcaagatcgcgggcaagcgcaccggc
ccctccgagatcgaggccctgctgatggacaccgggctgctgcaggacgcggctgcgatc
ggcgtgcccgatcccgtcaagggcacggcggtggtgtgcctgtgcgtgccgcgctccggc
atcgagaaggccggcgcggccgaggccctgtccgccgcggtcgccgcggggctgggcggg
gcgttccgccccgccagggtcgtcttcgtcgatgacctgccgcgcacgcgcaacatgaag
acgatgcgccgcgtgatccgtgccgcgtggctgggagacgaccccggagacctgagcacg
ctggtcaaccccgagtcggtgcaggccatccgcgcggcactcgcggcgcaggggccagcg
tga

DBGET integrated database retrieval system