KEGG   Alicycliphilus denitrificans K601: Alide2_4705Help
Entry
Alide2_4705       CDS       T01463                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Alide2_4705
Transfer RNA biogenesis [BR:adk03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Alide2_4705
 Prokaryotic Type
    Alide2_4705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4946905..4947309
Genome map
AA seq 134 aa AA seqDB search
MLKAVAIPAYKAFVACALGAAVVLAPAGASARQASEAAAIPPIALADLPPQGRATYALIR
EGGPFPYDKDGSVFGNRERLLPAKKRGYYREYTVRTPGVRSRGARRIVCGGAPRTPDACY
YTSDHYSSFREITQ
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggccgtcgccatcccggcgtacaaggcatttgtggcgtgtgctctgggtgcc
gcggtcgtacttgcgccggctggcgcgtccgcgcggcaggcttccgaggctgcggccatc
cctcccatcgcgctggccgacctgcccccccaggggcgcgccacctacgcgctgattcgt
gagggtggaccgtttccctacgacaaggacggctcggtcttcggcaatcgtgaacggctg
ttgcccgcgaaaaagcgcggctactaccgtgaatacaccgtgcgcacccctggcgtgagg
agccggggcgcacggcggatcgtatgcggcggagccccgcgcacgcccgatgcctgctac
tacaccagcgatcattacagtagttttcgagagatcacgcaatga

DBGET integrated database retrieval system