KEGG   Alicycliphilus denitrificans K601: Alide2_4766Help
Entry
Alide2_4766       CDS       T01463                                 

Definition
(GenBank) disulfide bond isomerase, DsbC/G
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
adk  Alicycliphilus denitrificans K601
Brite
Enzymes [BR:adk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Alide2_4766
Chaperones and folding catalysts [BR:adk03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Alide2_4766
Secretion system [BR:adk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Alide2_4766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: AEB87064
UniProt: F4GGU4
Position
pALIDE201:13675..14424
Genome map
AA seq 249 aa AA seqDB search
MIKRVLTLALAAALAVPAFAQDEAPASVVEKFKTMYPKTTFKEIRKSQVSGLYEVVMGEN
IAYTDESGRYFIFGHLFDMQQQVDLTAQRKLDSKKTEFPAQQLGQAIKTVKGDGSRILAV
FSDPDCPYCKQLEGELARLDNVTIYTFLYPLESLHPEAKTKAVSVWCAPNKAKAWSELML
AGKKPKLVACNNPVNDNLVLGSKLGVVGTPTLIAADGRVLPGSAPAEKIDQWLNAGKPGA
PAAAQEATQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgagtgttgaccctcgcgctggctgctgcgctggctgttcccgcatttgcc
caagatgaagcgcccgcgtccgtggtcgagaagttcaagaccatgtacccgaagacgacc
ttcaaggaaattcgcaagtcgcaagtttccgggctgtatgaggtagtgatgggcgagaac
atcgcctacaccgacgagtcgggccgctacttcattttcgggcacctgttcgacatgcag
cagcaagtcgatctgactgcccagcgcaagctcgatagcaagaaaaccgagttcccggca
cagcaacttggccaagcgatcaagacggtcaagggcgacggcagccgaatcctggccgtg
ttcagcgacccggattgcccctactgcaagcagttggagggcgagctggcccgcctggac
aacgtgaccatttacacgttcctgtacccgctcgaatcgctgcacccggaagccaagacc
aaggccgtcagcgtgtggtgcgcgccgaacaaggcgaaagcctggagcgagctgatgctg
gccggcaagaagcccaagctggtggcctgcaacaaccccgtcaacgacaacttggtgctg
ggttccaagctgggcgtggtgggcactcctaccctgattgccgccgatggccgcgtcctg
cctggttccgcaccggccgagaagatcgaccagtggctgaacgccggtaagcctggcgcg
ccggccgctgcgcaggaggcaacccaatga

DBGET integrated database retrieval system