KEGG   Auricularia delicata: AURDEDRAFT_55627Help
Entry
AURDEDRAFT_55627  CDS       T03129                                 

Definition
ferredoxin reductase-like protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
adl  Auricularia delicata
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AURDEDRAFT_55627
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AURDEDRAFT_55627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Unknown
AA seq 251 aa AA seqDB search
MRALTLAELNARRRRTERKPALDPGEWKEFPLIQKTPVSPNTAIYRFGLPHPEDILGLPI
GQHISIQAEISGKVIQRSYTPTSSDDDKGYFDLLVKAYEKGNISRHLSLLKIGDKIRVKG
PKGQFNYRPALSREFGMIAGGTGITPMLQIIRAVLKNPVDFTKINLIYANVNEEDILLKK
ELDDLAQTYPTRFYAYYVLNNPPAGWDGGIGFVTKDHIKDKMPTSSHDIKILLCGPPPMM
TAMKYGRSLLR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagagccttaaccttggccgaactaaacgcgcgacgtcgtcgtacagagcgcaagccc
gcgctggaccccggcgaatggaaggagttcccgctcattcagaaaacccccgtgtcgccc
aacacggccatataccggtttgggctgccccatcctgaggacatcctcgggctccccatt
ggccagcacatctccatccaggcggaaatctcgggcaaggtcatccagcggagctacacg
ccgacgagcagcgacgacgataagggctacttcgacctgctcgtcaaggcgtacgagaag
ggcaacatttcgcgtcacctctcgctactcaaaattggcgacaagatacgcgttaaggga
cccaagggccagttcaactaccgtcccgcgctctctcgcgaattcggtatgattgcgggc
ggcactggcatcacgcccatgctgcagattatccgtgcagtcctcaagaaccctgtcgac
ttcacgaaaattaacctcatttacgcgaacgtcaacgaggaggacatcctattgaaaaag
gagctcgacgatctcgcccagacttacccgacgcgcttctacgcctattacgttctcaac
aacccgcctgcaggctgggacggtggcataggctttgtgaccaaggaccacatcaaggac
aagatgccgacgagtagccacgacatcaagattctcctctgcggtccgccgccgatgatg
accgccatgaagtacggccgctctttgttgagataa

DBGET integrated database retrieval system