KEGG   Auricularia subglabra: AURDEDRAFT_63786Help
Entry
AURDEDRAFT_63786  CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
adl  Auricularia subglabra
Pathway
adl00052  Galactose metabolism
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AURDEDRAFT_63786
   00500 Starch and sucrose metabolism
    AURDEDRAFT_63786
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AURDEDRAFT_63786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: EJD45967
JGI: 63786
AA seq 529 aa AA seqDB search
MKILNLAIAASAILVAGVAGQDVDVPPSAAAAAALAGSIPDIYNGLYRPQVSFSPQQHFI
NDPCGLFVDASGLWHLYYQYNPAGLSGGNQHWGHATSTDLYHWKDEPIALYPSDAGQIWD
GSIVIDVNDTSGFFPNQTDGVAVIYTLNGQKETQRLAYSLDGGYTFTEYENNPVLDVNSS
QFRDPKLSWHEDHWVMVVAYATDLVVGFYTSPDLKEWTHASNFSFPGLGGLQWECPNLVE
VPIAGSDSGETMYVLKLSISPGAPLGGSIDLHFPGDFNGTHFAHVDGVAHLADFSKDNYA
TQFFYGTPQGADAISISWASNWQYGQDVPTANEGWRGQMAVPRRNYLANLPCEGWTLVQE
PYQLQSVLGPELGSSANGELYVNFSSVTSNAIYFEASVAGLSGVEVGADAWLNFTVLSPE
SGESLSGGYQFAGNGTFLLDRGNTHGFSHPDFTSTFTTSVSPDELGTWRASGIIDRSVME
VFINGGQHVATTTFYPTAPLTQFVAKSAGLPDGVNINVTVWGLESIWAQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcttaatcttgctattgccgcctcagcgattcttgtggctggcgttgcgggt
caggacgtcgacgtgcctccttctgctgctgctgctgccgctctcgcagggtccatcccg
gatatttacaacggcctgtaccgtcctcaggtgtccttctcgcctcaacagcatttcatt
aacgatccatgcggactcttcgtggatgccagcggactgtggcatttgtattatcaatac
aatcctgctggtctgtcgggcgggaatcaacactggggccatgcgacgagcacggaccta
tatcactggaaagacgagcccatagctctctacccaagtgacgcaggtcagatttgggac
ggatccatcgtcatagacgtcaacgatacctcgggtttcttccccaaccagaccgacggc
gtcgcagtcatctacacgctcaatggtcagaaggaaactcagcgtcttgcgtactctctc
gacggcggctacacgtttacggagtatgagaacaatcccgtcctcgatgtcaactcgagc
caattccgcgatccgaagttgtcgtggcacgaggatcactgggttatggtcgtcgcctat
gcgacggacctcgtcgtcggcttctacacgtcgccggacctcaaggagtggacgcacgcg
tcgaacttctcgttcccgggcctcggcgggctgcagtgggagtgtccgaacctggtcgag
gtgccgatcgccggaagcgactcgggcgagacgatgtacgtgctgaagcttagcatctcg
cctggcgcgccgctcggtgggtccatcgacctgcacttcccgggcgacttcaacggcacg
cacttcgcgcacgttgacggcgtcgcgcacctagccgacttctcgaaggacaactacgcg
acgcagttcttctatggcacgccgcagggcgcggatgcgatatcgatcagctgggcgtcc
aactggcagtacggccaggacgtccccaccgcgaacgagggctggcgcgggcagatggcc
gtcccgcgacgcaattacctcgcgaacctcccctgtgaggggtggacgctcgtccaggag
ccgtaccagctgcaatcggtgcttggtcctgagctcgggtcctcggccaacggcgagctg
tatgtgaacttcagcagcgtcacgtccaacgcgatctacttcgaggcgagcgtcgccggt
ctgtcgggcgtggaagttggcgccgacgcctggctcaacttcactgtgttgtctcccgag
tctggagagagtctcagcggcggctaccagttcgccgggaacggcacgttcctgctcgac
cgtggaaacacgcatgggttctcgcaccccgacttcacgagcacgttcaccacttccgtc
tcacccgatgagttgggcacatggcgcgcgtctggtatcattgacaggagcgtcatggag
gtctttatcaacgggggccagcacgtcgcgacgacaacgttctaccctactgccccactg
acacagttcgtcgccaagtccgccggtcttcccgacggtgtgaacatcaacgtgaccgtt
tggggactggagagtatatgggcgcagtga

DBGET integrated database retrieval system