KEGG   Alicycliphilus denitrificans BC: Alide_0034Help
Entry
Alide_0034        CDS       T01397                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Alide_0034
Enzymes [BR:adn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Alide_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(41877..43754)
Genome map
AA seq 625 aa AA seqDB search
MNFLLRSAAALLCSLFVGGAATAKPQVATLIVMPQDLRQNPQIVSDLQRRGINHATVYLT
WADVEAQPGHFDFSAYDPYFDQLTQGGLSLVVVLDMGGRAYFDGTGKHFPGRTTVPEWLY
RQVPDGFMKNFSGQSTPQPDFMNPTVRQFSAQFVRNAVAHLSQRYPGKVTAYSIGLQEEH
EIKYGQTGYQWRDYADAAQAAFRQQTGAPLPVINYTSDIALGLPRTEPLLHAHKQFREAN
LKEATCFYADAIRSQGGRAMSYFGELFTAHDGIYATSVAEQLADCLDIAVIDYNFYDGYS
LSPDARVLPMLANYMASVGYKQIMVGAYAEQWERVKKSTELLPVISRTLSTALAQPNVIG
YEVGGLQRQLDTHLTGTVDLDKLQALRVQPPVPATASTGKKLTVGILASTSNYYVWHGDR
SGGVNVHREALLEAYNLLSTQPGFDVHVIGEKNLQEDDLLQRLNAIVVPHQAALPASIKQ
QLKVYWKKGGTLVQDMRLGEFDENGKPVYDWMHEVFGIENITWRPRGGIFLTDDGQILRL
KPARKLYTGYAAMTPRPGYRLLATDILNKRQGIMVRGERTLVFGFTPQLVEDATQAMWQQ
IFVREIANAVRCPTPTTCKTPPRSP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccttctccgctcagccgcagcactgctgtgctctctgtttgtcggcggtgct
gcaactgccaagccgcaggtggccaccctcatcgtcatgccccaggatctgcgtcagaac
ccgcagatcgtcagcgacctacagcgccgaggcatcaaccacgccacggtgtaccttacc
tgggccgacgtcgaagcacagccgggccatttcgacttctcggcctacgacccgtacttc
gaccagctcacccagggtggactatcgcttgtcgtcgtgctcgacatggggggccgcgcg
tacttcgatggaacgggcaagcatttccccggccgcaccaccgtgcctgaatggctgtac
aggcaggtgcccgatgggtttatgaagaacttctcgggccagtccacgccgcagcccgac
ttcatgaaccccacggtgcgccagttctcggcccagttcgtgcgcaatgccgtggcccat
ctctcgcagcgctatcccgggaaggtcacggcctactccatcggcctgcaagaagagcat
gaaatcaaatacggccagaccggctaccagtggcgcgactacgccgacgccgcgcaggct
gccttccgccagcaaacgggcgcaccgctgcccgtcatcaactacaccagcgacattgcc
ctgggcctgcccaggacggagccgctgctgcacgcgcacaagcagttccgcgaagcgaat
ctgaaggaggccacctgcttctacgccgacgccatccgcagccagggcggccgcgccatg
agctactttggcgaactcttcaccgcgcacgacggcatctacgccaccagcgtggccgag
caactggccgactgcctggacattgccgtcatcgactacaacttctacgacgggtacagc
ttgtcgcccgacgcgcgcgtgctgcccatgctggccaactacatggcctcggtgggctac
aagcagatcatggtgggcgcctatgccgagcagtgggagcgcgtgaaaaaatccaccgaa
ctcctgcccgtcatcagccgcaccctgtccaccgcgctggcgcagccgaacgtgatcggc
tacgaggtgggcggtctgcagcgccaactcgacacgcacctcaccggcacggtggatctc
gataagctccaggccctgcgcgtgcagccccccgtgcccgccactgccagcacgggaaag
aagctcaccgtgggcatcctcgcctccaccagcaactactacgtatggcacggggaccgc
agcggcggcgtcaacgtgcaccgcgaggcgctgctcgaagcctacaacctcctgagcacg
cagccgggcttcgacgtccacgtcatcggtgaaaagaacctgcaggaagacgatctgctg
cagcgcctgaacgccatcgtagttccacaccaagccgccctgcccgcatccatcaagcag
cagctcaaggtctactggaaaaagggcggcacgctggtccaggacatgcgccttggcgaa
ttcgatgagaacggcaaacccgtctacgactggatgcacgaggttttcggcatcgagaac
attacgtggaggccgcgcggcggcatcttcctgacggacgacggccagatcctgcgcctg
aaacctgcgcgcaagctgtacacgggctacgcggccatgaccccgcgtcctggctatcgc
ctgctggccaccgacatcctcaacaagcgccaaggcatcatggtgcgtggcgaacggacg
ctggtgttcggcttcacgccgcaattggtcgaagatgccacccaggccatgtggcagcag
attttcgtgcgcgaaatcgccaacgccgtgcgatgccccacgcccactacttgtaaaacg
cctccacgctccccttga

DBGET integrated database retrieval system