KEGG   Alicycliphilus denitrificans BC: Alide_0380Help
Entry
Alide_0380        CDS       T01397                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:adn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(407305..408216)
Genome map
AA seq 303 aa AA seqDB search
MPPVTLIGAPTDVGASVLGASMGPDALRIAGIARALRTLEPDVQDMGNLSGPGNPQAAPS
GGFRHLAEVTAWSQAVFSAALAALDAGRLPLLMGGDHCLAIGSISAAARHCRLRGRRLKV
LWLDAHADANTPASSPSGNLHGMPVACLLGHGPRQLTQLAGAAPALQARQITLLGVRSVD
ATEKRFVNAQGIEVYDMRSIDELGMRSVMQAALADVDENTHLHLSFDMDGLDPTIAPGVG
TPVRGGPTYRETQLCMEMLADSGALGSVDVMELNPALDVRNQTAELAVDLLESLFGKSTL
MRA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccgtgaccctgatcggcgcccccaccgacgtgggcgccagcgtgctcggcgcc
agcatggggccggacgcgctgcgcatcgcgggcatcgcccgcgccctgcgcacgctggag
cccgacgtgcaggacatgggcaacctgagcggcccgggcaacccacaggccgcgcccagc
gggggcttccggcacctggccgaggtgacggcctggagccaggcggtgttctccgccgcg
ctggccgcgctcgacgccggccggctgccgctgctcatggggggcgaccattgcctggcg
atcggctcgatcagcgccgcggcgcggcactgccgcctgcgcggccggcgcctgaaggtg
ctgtggctcgacgcccacgccgacgcgaacacgccggcctcgtcgcccagcggcaacctg
cacggcatgcccgtggcctgcctgctgggccatgggccgcggcagctcacgcaactggcg
ggcgcggccccggcgctgcaggcgcggcagatcacgctgctcggcgtgcgcagcgtggac
gcgaccgagaagcgcttcgtcaacgcgcagggcatcgaggtgtacgacatgcgcagcatc
gacgagctgggcatgcgctccgtgatgcaggcggccctggccgacgtggacgagaacacg
cacctgcacctgagcttcgacatggatggcctggaccccacgatcgcgcccggcgtgggc
acgccggtgcgcggcggcccgacctaccgcgagacccagctgtgcatggagatgctggcc
gacagcggcgccctgggctcggtggacgtcatggagctgaacccggcgctggacgtgcgc
aaccagacggccgagctggcggtggacctgctggagagcctgttcggcaagtccacgctg
atgcgcgcgtag

DBGET integrated database retrieval system