KEGG   Alicycliphilus denitrificans BC: Alide_0399Help
Entry
Alide_0399        CDS       T01397                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00860  Porphyrin and chlorophyll metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alide_0399
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Alide_0399
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alide_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADU98175
JGI: Alide_0399
UniProt: E8TVG5
Position
complement(427326..428354)
Genome map
AA seq 342 aa AA seqDB search
MWGTITPMHLSSPTPFPANRPRRLRRDAFTRDLVRENRLTPHDFIYPVFVHEGTQLRVPV
PSMPGVERLSLDLLLPVAGECVRLGIPYLALFPSIDAQLKTPDGKEALNPEGLIPRVVRA
LKKEFPQLGVMTDVALDPYTSHGQDGMLDDTGYILNDETVEILVGQALAHAQAGVDMVAP
SDMMDGRIGAIRDALEAHGHIHTRIMAYSAKYASAFYGPFRDAVGSAANLGRSNKDVYQM
DPANTDEALREVALDLAEGADMVMVKPGMPYLDVLRRVKDEFKVPTFAYQVSGEYAMLKA
AAANGWLDHDKVMLEALLAFKRAGADGILTYFALDAARLLTK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggacaatcacccccatgcatctgtccagccccacccccttccccgccaaccgc
ccgcgccggctgcgccgcgacgcgttcacccgcgacctggtgcgcgagaaccggctcacg
ccgcacgacttcatctaccccgtgttcgtgcacgaaggcacgcagctgcgcgtgcccgtg
ccttccatgcccggcgtggagcgcctgagcctggacctgctgctgccggtggccggggaa
tgcgtgcggctcggcattccctacctggcgctgttcccctccatcgacgcgcagctcaag
acgcccgacggcaaggaggccctgaaccccgagggcctgatcccgcgcgtggtgcgcgcg
ctgaagaaggagttcccgcagctcggcgtgatgaccgacgtggcgctggacccctacacc
agccacggccaggacggcatgctcgacgacaccggctacatcctgaacgacgagacggtc
gagatcctcgtgggccaggcgcttgcccacgcccaggccggcgtggacatggtggcgccc
agcgacatgatggacgggcgcatcggcgcgatccgcgacgcgctggaggcccacggccac
atccacacgcgcatcatggcctacagcgccaagtacgccagcgccttctacgggccgttc
cgcgacgccgtgggctcggccgccaacctggggcgcagcaacaaggacgtctaccagatg
gacccggccaacaccgacgaggcgctgcgcgaggtggcgctggatctggccgagggcgcc
gacatggtcatggtcaagcccggcatgccgtacctggacgtgctgcgccgcgtgaaggac
gagttcaaggtgcccaccttcgcctaccaggtcagcggcgagtacgccatgctcaaggcc
gccgcggccaacggctggctggaccacgacaaggtgatgttggaggcgctgctggccttc
aagcgcgccggcgctgacggcatcctgacctacttcgccctggacgccgcacggctgctc
acgaaataa

DBGET integrated database retrieval system