KEGG   Alicycliphilus denitrificans BC: Alide_0579Help
Entry
Alide_0579        CDS       T01397                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:adn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
613666..614238
Genome map
AA seq 190 aa AA seqDB search
MIGKLTGALLEKNPPEVLLDCHGVGYEVLVPMSTFYNLPAVGQPVSLLTQFIVREDAQLL
YGFATQQERQAFRELIKVSGVGPRTALSILSGLGVADLAQAVSLQEAGRLVKVPGIGKKT
AERLLLELKGKLGADMGGRPHAASADQADILQALLALGYNDKEAAAALKGLPADVGVSEG
IKLALKSLAR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaattgaccggcgcgctgctggaaaagaacccccccgaggtgctgctggac
tgccatggcgtgggctacgaggtgctggtgcccatgagcaccttctacaacctgcccgcc
gtggggcagccggtgagcctgctcacgcagttcatcgtgcgcgaggacgcgcagctgctc
tatggcttcgccacgcagcaggagcgccaggcgttccgcgagctcatcaaggtcagcggc
gtggggccgcgcacggcgctgtccatcctctcggggctgggcgtggcggacctggcgcag
gccgtgtcgctgcaggaggcaggccgcctggtcaaggtgccgggcataggcaagaagacc
gccgagcgcctgctgctggagctcaagggcaagctgggcgcggacatgggcggcaggccg
cacgcggccagcgcggaccaggccgacattctccaggcgctgctggcgctcggctataac
gacaaggaagctgcggcggcgctcaaggggctgccggccgacgtgggcgtgagcgagggg
atcaagctggcgctgaagtcgctggcccggtag

DBGET integrated database retrieval system