KEGG   Alicycliphilus denitrificans BC: Alide_0598Help
Entry
Alide_0598        CDS       T01397                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00010  Glycolysis / Gluconeogenesis
adn00052  Galactose metabolism
adn00500  Starch and sucrose metabolism
adn00520  Amino sugar and nucleotide sugar metabolism
adn00521  Streptomycin biosynthesis
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_0598
   00052 Galactose metabolism
    Alide_0598
   00500 Starch and sucrose metabolism
    Alide_0598
   00520 Amino sugar and nucleotide sugar metabolism
    Alide_0598
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Alide_0598
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Alide_0598
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Alide_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADU98367
JGI: Alide_0598
UniProt: E8TX99
Position
631170..632129
Genome map
AA seq 319 aa AA seqDB search
MLAGVDIGGTKVAVCLAVPSGAGGPPALLARLSEPTVKTGEADALARQVLRLLDAACAAQ
GLARGDVAAVGVASCGPFVRRAGRVEVSNPNICGGLAGAPRGLGNGWTRVPLEAPLAQAM
GEGRVQVANDAVAALAAERRWGALRGVDDCAYVTWSTGIGVGLCVDGRVLRGKNGNAGHA
GHSFVGDVAGEPPLCGCGNRGDVESLVAGNALPRRLGLQAPALLDAAARGDAAALAQVRG
LCALMGRLLYNLVATLDLRRISIGGAVFLHHESLLLPLLRAELARHFAVLTDGVELVRAG
LGERVGDYAALALLDSSSA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggcgtggacatcggcggcaccaaggtggccgtgtgcctggccgtgccgtcc
ggcgccggcgggccgcccgcgctgctcgcgcgcctgagcgagcccaccgtcaagaccggc
gaggccgatgcgctcgcgcggcaggtgctgcgcctgctggacgcggcctgcgccgcgcag
gggctggcgcgcggcgacgtggcggccgtgggcgtcgcgtcgtgcgggccgttcgtgcgc
cgcgcgggccgggtggaggtgagcaaccccaacatctgcggcggcctcgcgggcgcgccg
cggggcctgggcaacggctggacccgcgttccgctggaggcgccgctggcgcaggcgatg
ggcgaggggcgcgtgcaggtggccaacgacgcggtggccgcgctggccgccgagcgccgc
tggggcgcgctgcgcggcgtggatgactgcgcctacgtgacctggagcaccggcatcggc
gtgggcctgtgcgtggacgggcgcgtgctgcgcggcaagaacggcaacgcggggcatgcg
ggccattccttcgtcggcgatgtggcgggcgagccgccgctgtgcggctgcggcaaccgg
ggcgacgtggagtcgctcgtcgcgggcaatgcgctgccgcgccggctggggctgcaggcg
ccggccctgctggacgccgccgcgcgcggcgacgcggcggcgctcgcgcaggtgcgcggg
ctgtgcgcgctcatggggcggctgctctacaacctggtggccacgctggacctgcggcgc
atcagcatcggcggcgcggtgttcctgcaccacgagtcgctgctgctgccgctgctgcgc
gcggagctggcgcgccacttcgccgtgctgaccgatggggtggagctggtgcgcgcgggc
ctgggcgagcgggtgggcgactacgcggcgctggcgctgctcgattcctccagcgcctga

DBGET integrated database retrieval system