KEGG   Alicycliphilus denitrificans BC: Alide_0745Help
Entry
Alide_0745        CDS       T01397                                 

Definition
exosortase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alide_0745
Enzymes [BR:adn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Alide_0745
Peptidases [BR:adn01002]
 Cysteine Peptidases
  Family C44
   Alide_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
783735..785645
Genome map
AA seq 636 aa AA seqDB search
MCGISGIFDTRGTSTIPRDLISRINNIQSHRGPDENEVHLEPGLALGHRRLSVIDLATGT
QPLFNEDGTVGIVFNGEIYNYLELMQELKDLGYRFRTRSDTEVIVHAWQAWGEACVHRLR
GMFAFALWDRKHQTLFLARDRMGVKPMHYAWLPDGSFIFGSELKVLTAHPGFVRDIDPLA
VEGYFSFGYVPDPRCIYQNAHKLPAAHTLTLRRGDAGRPVPRPYWDVRFTNDNPIKLQDA
QAELRERVRESVRLRMIADVPLGAFLSGGVDSSAVVATMAGLSSAPVHTCSIGFDDPRFD
ESSFAQQVADRYRTDHRLDIVSSDDFDLIDTLAWLYDEPFADSSAIPTYRVCQMARKHVT
VALSGDGGDESIGGYRRYRMHLGEEAVRGRLPLALRRGMFGPLGRWYPKADWAPRSLRAK
TTFQALAMDSVQAYCHSMSQLRGDERRALFSPAFQRSLGGYGALEVFRLYAGQAQTEDSL
ALIQYLDYKTWLVGDINTKVDRASMAHSLEVREPLMDHLLVEWLATLPSDFKIRAGQGKV
IFKQAYEPLLPRDVLYRPKMGFSVPLAAWLRGPLKDRVRLALLGERMRDCGYFNPVTLRR
LVDEHNSGLRDHATALWMLLMFEAFLRLNEGAALHG
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttccggcattttcgacacgcggggcacgagcacaatcccgcgcgacctg
atttcgcggatcaacaacatccaatcccaccgtggaccagacgagaacgaggtccacctg
gagcccggcctggcactggggcaccggcgcctgtcggtcatcgacctggccacgggcact
cagcctctgttcaatgaagacggcaccgtgggcatcgtcttcaatggcgagatctataac
taccttgagttgatgcaggagctcaaggatttaggctaccgtttcaggacgcgcagcgac
actgaagtgatcgtgcatgcctggcaggcctggggtgaggcgtgcgtacacaggctcaga
ggcatgttcgcctttgccttgtgggatcgcaagcaccaaaccttgtttcttgcgcgcgac
cgcatgggcgtcaagcccatgcattacgcgtggttgccggacggcagcttcatttttggc
tccgagctcaaagtgctgaccgcccacccgggtttcgtgcgcgacatcgatccgctcgcg
gtggaaggctatttttcgttcgggtatgttcccgatccgcgctgcatctatcagaacgcc
cacaagctgccagcggcccacacgctcacgctgcgccgtggcgatgcaggtaggccagtt
ccacgcccctactgggatgtgcgcttcaccaacgacaaccccatcaagctgcaggacgcg
caagccgagctgcgtgagcgcgtgcgcgagtccgtgcgcctgcgcatgatcgccgatgtg
ccactgggcgccttcctgtctgggggggtggattccagtgccgtggtggccaccatggcg
ggcctgtccagcgcgccggtgcacacctgctccatcgggtttgacgatccccgtttcgac
gagtcgagcttcgcccagcaggtggccgatcgttaccggaccgaccataggctggatatc
gtcagcagcgacgacttcgatctcatcgacaccttggcttggctctacgacgagcccttt
gcggacagctcggccattcccacatatcgcgtctgccagatggcgcgcaagcacgtcacc
gtggcgctgtccggtgacgggggcgacgagagcattggcggttaccggcgctaccgcatg
catcttggcgaggaggccgtgcgcggacgcctgccactcgccctgcgccgcggcatgttc
ggaccattggggcgctggtatcccaaggcagactgggcgccacgttcgctgcgcgccaag
accactttccaggccctggccatggacagtgtgcaggcatactgccacagcatgtcccaa
ctgcgtggcgacgagcgccgcgcgctgttctcgccggccttccagcgcagcttggggggc
tacggcgcacttgaagtgtttcgcctgtatgccgggcaggcccagaccgaagactcgctg
gccctgatccagtacctggactacaagacctggctggtgggcgacattaacaccaaggtc
gatcgcgccagcatggcccattcgctggaggtacgcgagccactgatggatcatctgctg
gtggagtggctggccacgctgcccagcgacttcaagattcgcgcaggccagggcaaggtc
atcttcaagcaggcctatgaacccctgctgccgcgcgacgtgctgtatcggccaaagatg
gggttttcggtaccgctggcggcctggttgcgcggcccgttgaaagaccgtgtgcgcctg
gcgctgctgggcgagcgcatgcgtgactgtggctacttcaaccccgtgaccctgcgccgc
ttggtcgatgagcacaacagcggcctgcgcgaccacgccaccgcgctgtggatgctgctc
atgttcgaggccttcctgcgcctgaacgaaggggccgctcttcatggctaa

DBGET integrated database retrieval system