KEGG   Alicycliphilus denitrificans BC: Alide_0874Help
Entry
Alide_0874        CDS       T01397                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:adn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929673..930989
Genome map
AA seq 438 aa AA seqDB search
MQFVAAPARLSTVSDAFEADFAARLHWSADQDAAIEERVAAILADVQQRGDAAVLDYTRR
FDGLQADGVAALELTQAELKAAYDGLPDAQRQALSAAAARVRSYHEAQKKACGESWSYRD
EDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVPEIIMVVPTPRGEKNPL
VLAAACVAGVTRAFTIGGAQAVAALAHGTATIPKVDKITGPGNAYVASAKKRVFGQVGID
MIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDAAYIDAVQREIDRLLPQ
MPRAEIIARSLTGRGALIHTRSMEEACEISNRIAPEHLEVSSRDPHKWEPLLRHAGAIFL
GAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEQGAQALGRIASVL
AHGEGLQGHARAAEMRLK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgtagctgctcccgcccgcctgtcaaccgtttcagacgctttcgaggctgat
ttcgcggcccgcctgcactggtcggccgaccaggacgcagccatcgaggaacgcgtggcc
gccatcctggccgacgtgcagcagcgcggcgacgcggccgtgctcgactacacccggcgc
ttcgacggcctgcaggccgacggcgtggccgcgctggaactcacgcaggccgaactcaag
gccgcctacgacggcctgcccgatgcgcagcgccaggccttgagcgccgccgccgcgcgc
gtgcgcagctaccacgaggcgcagaagaaagcctgcggcgagagctggagctaccgcgac
gaggacggcaccctgctgggccagaaggtcacgccgctcgaccgcgtgggcatctacgtg
cccggcggcaaggcggcctacccgagcagcgtgctcatgaacgccatccccgcccacgtg
gccggcgtgcccgagatcatcatggtcgtgcccacgcccaggggcgagaagaacccgctg
gtgctggccgccgcctgcgtggccggcgtcacgcgcgccttcaccatcggcggcgcgcag
gccgtggccgcgctggcccacggcacggccaccatcccgaaggtggacaagatcaccggt
cccggcaacgcctacgtggccagcgccaagaagcgcgtgttcggccaggtgggcatcgac
atgatcgcgggcccgagcgaaatcctggtgctggccgacggcagcacgccgcccgactgg
gtggccatggacctgttctcgcaggccgagcacgacgagctcgcccagtccatcctgctg
tgccccgacgccgcctacatcgacgcagtgcagcgcgagatcgaccgcctgctgccccag
atgccgcgcgccgaaatcatcgccaggagcctcacgggccgcggcgcgctgatccacacg
cgcagcatggaagaggcctgcgaaatctccaaccgcatcgcgcccgagcacctggaagtc
tccagccgcgacccgcacaagtgggagccgctgctcaggcacgcgggtgccatcttcctg
ggcgcctataccagcgaaagcctgggcgactactgcgccggccccaaccacgtgctgccc
acgagcggcacggcgcgcttctcgtcgcccctgggcgtgtacgacttccagaagcgcagc
agcctcatcgaggtcagcgagcagggcgcccaggcgctgggccgcatcgccagcgtgctg
gcgcacggggaaggcctgcaggggcatgcgcgcgcggcggagatgcggctgaagtag

DBGET integrated database retrieval system