KEGG   Alicycliphilus denitrificans BC: Alide_0874Help
Entry
Alide_0874        CDS       T01397                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00340  Histidine metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Alide_0874
Enzymes [BR:adn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Alide_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADU98639
JGI: Alide_0874
UniProt: E8U091
Position
929673..930989
Genome map
AA seq 438 aa AA seqDB search
MQFVAAPARLSTVSDAFEADFAARLHWSADQDAAIEERVAAILADVQQRGDAAVLDYTRR
FDGLQADGVAALELTQAELKAAYDGLPDAQRQALSAAAARVRSYHEAQKKACGESWSYRD
EDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVPEIIMVVPTPRGEKNPL
VLAAACVAGVTRAFTIGGAQAVAALAHGTATIPKVDKITGPGNAYVASAKKRVFGQVGID
MIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDAAYIDAVQREIDRLLPQ
MPRAEIIARSLTGRGALIHTRSMEEACEISNRIAPEHLEVSSRDPHKWEPLLRHAGAIFL
GAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEQGAQALGRIASVL
AHGEGLQGHARAAEMRLK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgtagctgctcccgcccgcctgtcaaccgtttcagacgctttcgaggctgat
ttcgcggcccgcctgcactggtcggccgaccaggacgcagccatcgaggaacgcgtggcc
gccatcctggccgacgtgcagcagcgcggcgacgcggccgtgctcgactacacccggcgc
ttcgacggcctgcaggccgacggcgtggccgcgctggaactcacgcaggccgaactcaag
gccgcctacgacggcctgcccgatgcgcagcgccaggccttgagcgccgccgccgcgcgc
gtgcgcagctaccacgaggcgcagaagaaagcctgcggcgagagctggagctaccgcgac
gaggacggcaccctgctgggccagaaggtcacgccgctcgaccgcgtgggcatctacgtg
cccggcggcaaggcggcctacccgagcagcgtgctcatgaacgccatccccgcccacgtg
gccggcgtgcccgagatcatcatggtcgtgcccacgcccaggggcgagaagaacccgctg
gtgctggccgccgcctgcgtggccggcgtcacgcgcgccttcaccatcggcggcgcgcag
gccgtggccgcgctggcccacggcacggccaccatcccgaaggtggacaagatcaccggt
cccggcaacgcctacgtggccagcgccaagaagcgcgtgttcggccaggtgggcatcgac
atgatcgcgggcccgagcgaaatcctggtgctggccgacggcagcacgccgcccgactgg
gtggccatggacctgttctcgcaggccgagcacgacgagctcgcccagtccatcctgctg
tgccccgacgccgcctacatcgacgcagtgcagcgcgagatcgaccgcctgctgccccag
atgccgcgcgccgaaatcatcgccaggagcctcacgggccgcggcgcgctgatccacacg
cgcagcatggaagaggcctgcgaaatctccaaccgcatcgcgcccgagcacctggaagtc
tccagccgcgacccgcacaagtgggagccgctgctcaggcacgcgggtgccatcttcctg
ggcgcctataccagcgaaagcctgggcgactactgcgccggccccaaccacgtgctgccc
acgagcggcacggcgcgcttctcgtcgcccctgggcgtgtacgacttccagaagcgcagc
agcctcatcgaggtcagcgagcagggcgcccaggcgctgggccgcatcgccagcgtgctg
gcgcacggggaaggcctgcaggggcatgcgcgcgcggcggagatgcggctgaagtag

DBGET integrated database retrieval system