KEGG   Alicycliphilus denitrificans BC: Alide_0929Help
Entry
Alide_0929        CDS       T01397                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:adn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
985881..987020
Genome map
AA seq 379 aa AA seqDB search
MVSSVLRDARRIVVKVGSSLVTNEGRGLDEVAIGEWSRQLAALVRGEGGEPREVIMVSSG
AIAEGMKRLGWSARPSEIHELQAAAAVGQMGLAQMYETKLREQAMRSAQVLLTHADLADR
ERYLNARSTLLTLLRLGVVPVINENDTVVTDEIKFGDNDTLGALVANLVEADVLVILTDQ
KGLYTADPRRDPGAQFVHEAQAGDPALEVMAGGAGSSIGKGGMITKIVAARRAAGSGAST
VIAWGREPDVLLRLAQGEPIGTLLVAQTQKKQARKQWMVDHLQLRGSVTVDAGAAAKLRD
EGKSLLPIGMVAVEGDFVRGDVIAVRDAGGTEIARGLANYASAEARLLCRRPSSEFERLL
GYAAEPEMVHRDNMVVSGN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggtttccagtgtcttgcgcgacgcgcgtcgcatcgttgtcaaagtggggtccagccta
gtcaccaatgaggggcggggcctggacgaggtcgccatcggggagtggagccggcagctc
gcggccctggtgcgcggcgagggcggcgagccgcgcgaggtcatcatggtctctagcggc
gccatcgccgagggcatgaagcggctgggctggtccgcccgccccagcgagatccacgag
ctgcaggccgctgccgccgtggggcagatgggtctggcgcagatgtacgagaccaagctg
cgcgagcaggccatgcgcagcgcgcaggtgctgctcacgcacgccgacctggccgaccgc
gagcgctacctcaacgcccgctccactctgctgaccctgctgcgcctgggcgtggtgccg
gtgatcaacgaaaacgacaccgtggtcacggacgagatcaagttcggcgacaacgacacc
ctgggcgccctggtggccaacctggtggaggcggacgtcctcgtcatcctgaccgaccag
aaggggctgtacacggccgacccgcgccgcgaccctggggcccaattcgtgcacgaggcg
caggcgggagacccggcgctggaggtgatggccggcggcgcgggttcgagcatcggcaag
ggcggcatgatcaccaagatcgtggcggcgaggcgggcggcgggctcgggcgcatccacc
gtgatcgcctgggggcgcgagcccgacgtgctgctgcgcctggcgcagggcgaacccatc
ggcacgctgctcgttgcgcagacgcagaagaagcaggcgcgcaagcagtggatggtggac
cacctgcagctgcgcggatcggtgaccgtggatgcgggcgcggctgccaagctgcgcgat
gaaggcaagagcctactgcccatcggcatggtcgcggtcgagggggatttcgtgcgtggc
gacgtgatcgccgtgcgcgacgctggcggcacggagatcgcccgcggcctggccaattac
gcgagcgccgaggcgcgcctgctgtgccgcaggccctcgtccgaattcgagcgcctgctg
ggctatgcggctgagccggagatggtgcaccgggacaacatggtggtgtccggcaactga

DBGET integrated database retrieval system