KEGG   Alicycliphilus denitrificans BC: Alide_0964Help
Entry
Alide_0964        CDS       T01397                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:adn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1025029..1025754
Genome map
AA seq 241 aa AA seqDB search
MSSEPAAEPNAPPSDEGTPVSVKIRERLAAARRRFHANDNIAEFIEPGELELLLDEVEAR
MQGVLDSMVIDTAGDHNTQSTARRVAKMYLNEVFKGRYVHPPTITEFPNAEHLNELMIVG
PITVRSACSHHFCPVIGKIWIGVLPNEHTNVIGLSKYARLVDWVMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVREMDSKMINSVMRGVFLTNSTLRREFLALIPGR
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaacccgcagcagaaccgaacgccccgccgtccgacgagggcacgcccgtt
tccgtcaagatccgcgaacggctggccgcggcgcgccggcgcttccatgccaacgacaac
atcgccgagttcatagagccgggcgagctggaactgctgctcgacgaggtcgaggccagg
atgcagggcgtgctcgacagcatggtcatcgacacggccggcgaccacaacacgcagagc
accgcgcgccgcgtggccaagatgtacctgaacgaggtcttcaagggccgctacgtgcac
ccgcccacgatcaccgagtttccgaacgccgagcacctgaacgagctcatgatcgtcggc
ccgatcaccgtgcgcagcgcctgcagccaccatttctgccccgtgatcggcaagatctgg
atcggcgtgctgcccaacgagcacaccaacgtcatcggcctgtccaagtacgcgcgcctg
gtggactgggtcatgggccggccgcagatccaggaggaggccgtggtgcagctcgccgac
ctgatcatggagaagacccagcccgacggcctggccatcgtcatggaggccagccacttc
tgcatgtcctggcgcggcgtgcgcgagatggacagcaagatgatcaactccgtgatgcgc
ggcgtgttcctgaccaactccacgctgcgccgcgaattcctggcactcatccccggaagg
aactga

DBGET integrated database retrieval system