KEGG   Alicycliphilus denitrificans BC: Alide_0964Help
Entry
Alide_0964        CDS       T01397                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00790  Folate biosynthesis
adn01100  Metabolic pathways
Module
adn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alide_0964
Enzymes [BR:adn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Alide_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADU98729
JGI: Alide_0964
UniProt: E8U0X8
Position
1025029..1025754
Genome map
AA seq 241 aa AA seqDB search
MSSEPAAEPNAPPSDEGTPVSVKIRERLAAARRRFHANDNIAEFIEPGELELLLDEVEAR
MQGVLDSMVIDTAGDHNTQSTARRVAKMYLNEVFKGRYVHPPTITEFPNAEHLNELMIVG
PITVRSACSHHFCPVIGKIWIGVLPNEHTNVIGLSKYARLVDWVMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVREMDSKMINSVMRGVFLTNSTLRREFLALIPGR
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaacccgcagcagaaccgaacgccccgccgtccgacgagggcacgcccgtt
tccgtcaagatccgcgaacggctggccgcggcgcgccggcgcttccatgccaacgacaac
atcgccgagttcatagagccgggcgagctggaactgctgctcgacgaggtcgaggccagg
atgcagggcgtgctcgacagcatggtcatcgacacggccggcgaccacaacacgcagagc
accgcgcgccgcgtggccaagatgtacctgaacgaggtcttcaagggccgctacgtgcac
ccgcccacgatcaccgagtttccgaacgccgagcacctgaacgagctcatgatcgtcggc
ccgatcaccgtgcgcagcgcctgcagccaccatttctgccccgtgatcggcaagatctgg
atcggcgtgctgcccaacgagcacaccaacgtcatcggcctgtccaagtacgcgcgcctg
gtggactgggtcatgggccggccgcagatccaggaggaggccgtggtgcagctcgccgac
ctgatcatggagaagacccagcccgacggcctggccatcgtcatggaggccagccacttc
tgcatgtcctggcgcggcgtgcgcgagatggacagcaagatgatcaactccgtgatgcgc
ggcgtgttcctgaccaactccacgctgcgccgcgaattcctggcactcatccccggaagg
aactga

DBGET integrated database retrieval system