KEGG   Alicycliphilus denitrificans BC: Alide_1044Help
Entry
Alide_1044        CDS       T01397                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide_1044
   01230 Biosynthesis of amino acids
    Alide_1044
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_1044
   00051 Fructose and mannose metabolism
    Alide_1044
   00562 Inositol phosphate metabolism
    Alide_1044
Enzymes [BR:adn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alide_1044
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alide_1044
  Exosomal proteins of bladder cancer cells
   Alide_1044
  Exosomal proteins of melanoma cells
   Alide_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1111861..1112664
Genome map
AA seq 267 aa AA seqDB search
MDDMTQKKKLIAGNWKMNGSLQANAALLQALRDGLGEAACAVAVAVPAPYLAQVQGLVAG
SAIALAAQDVSQHESGAFTGEVSAAMLRDFGTRYVLVGHSERRQYHGETDAVVAAKAQRA
LAAGITPIVCVGETLAEREAGQTEAVVKRQLAAVVQSNGQCISEIVVAYEPVWAIGTGRT
ATPEQAQQVHAVLRAQLAAATERADRVSLLYGGSMNAANAAQLLAQPDIDGGLVGGASLK
AADFLQIIAAAHAIQAQAATELGAEKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatgactcagaaaaagaaactcattgccggcaactggaagatgaacggcagc
ctgcaggccaacgcggccctgctgcaggcgctgcgcgacgggctcggcgaggccgcctgc
gccgtggccgtggccgtcccggcgccgtacctggcgcaggtgcaggggctggtcgccggc
tcggcgatcgcgcttgccgcccaggacgtgtcgcagcatgagtcgggcgcgttcacggga
gaggtctccgcggccatgctgcgcgacttcggcacgcgctacgtgctcgtggggcactcc
gaacgccgccagtaccacggcgagacagatgccgtggtggcggccaaggcgcagcgcgcg
ctggcggctggcatcacgcccatcgtgtgcgtgggcgagaccctggcggagcgcgaggcg
gggcagacggaggccgtggtcaagcgtcagctggcggcggtggtgcagtccaatggccag
tgcatcagcgaaatcgtggtcgcctacgagcccgtctgggccatcggcacgggccgcacg
gcgacccccgagcaggcccagcaggtgcacgccgtgctgcgcgcccagctggcggcggcg
accgagcgcgccgaccgcgtgtccctgctgtacggtggcagcatgaatgccgccaacgcg
gcgcagctgctggcgcagcccgacatcgacggcggcctggtgggcggggcctcgctcaag
gccgcggattttctgcaaattattgctgcagcgcatgcgatacaagcgcaagcagctacg
gaattaggagctgaaaaagcatga

DBGET integrated database retrieval system