KEGG   Alicycliphilus denitrificans BC: Alide_1317Help
Entry
Alide_1317        CDS       T01397                                 

Definition
rela/spot family protein (EC:2.7.6.5)
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Alide_1317
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     Alide_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1391383..1393629
Genome map
AA seq 748 aa AA seqDB search
MKSSFIGQTLPMAQAGAAAARPDGVPQLIAATSQADTEHADALVRARAFAEPLLIGETLE
TGENTLAHADAVAAILKNLGGSETMQAAAYLVYTCEHLNKPEEVIGKAFGSNFAALAVET
TKLMRVQLQAREAQVAGLQVDDAATQTENVRKMLLAFSRDLRVVMLRLASRLQTLRYYAA
AKRPVSPAIAREALQVFAPLANRLGIWQMKWELEDLAFRFLEPDTYREVARLLDEKRVER
ELYMEQLRGRLESELRAHSISASVSGRPKHIYSIVKKMRGKSLDFDQVFDIRALRVIVPS
VKDCYAALSWVHSQFTSIEAEFDDYIARPKPNGYQSLHTVVRDEAGRAIEIQIRTQAMHD
HAEHGVAAHWAYKEAGTKGYAGVSASSDYDAKIAVLRQLLAWERDLVGSASRSGLFEDRI
YVLTPDAAVVELPQGATPVDFAYAVHTNVGHRCRGARVDGAMVPLNTPLQNGQTVEISTV
KEGRPSRDWLNPELGYLTSSRAKAKVRAWFNAQATHATVARGRELVEKLLQREGKTAIKH
DDLAMQLGFKSADALFEMVGKDELSLRSIEALLRPPEPVAQEPDLLVRKARTADGAHKGG
VLVVGVDSLMTQLAKCCKPAPPDDIRGFVTRGKGVSVHRSDCRNFHEMAARNAERVIDVQ
WGRPRRSTAEAAVYPVDVAVEASDRQGLLRDISEVFAREKTNVIGVQTQSVKGTAWMTFT
VEVSDAGRLNKVLGIVAGVQGVRSARRR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcttcatcggccagacgctgcccatggcgcaggcgggcgccgctgcggcg
cgtcccgacggcgtgccgcagctcatcgcggccacgtcgcaggccgatacggagcatgcc
gacgccctggtgcgcgcccgtgcgttcgccgagcccctgctcatcggcgaaacgctggag
accggggagaacacgctggcccatgcggacgcggtggccgccatcctcaagaacctgggc
ggctccgagaccatgcaggcggcggcctacctggtctacacctgcgagcacctgaacaag
cccgaggaggtgatcggcaaggccttcggcagcaatttcgcggctctggccgtggagacc
accaagctcatgcgcgtgcagctgcaggcgcgcgaggcgcaggtggccggcctgcaggtg
gacgatgcggccacgcagaccgagaacgtgcgcaagatgctgctggccttctcgcgcgac
ctgcgcgtggtcatgctgcgcctggcctcgcgcctgcagacgttgcgctactacgcggcc
gccaagcgcccggtgtcgccggccatcgcgcgcgaggcgctgcaggtgttcgcccccctg
gccaaccgcctgggcatctggcagatgaaatgggagctggaagacctggccttccgcttc
ctggagcccgacacctaccgcgaggtggcgcgcctgctcgacgagaagcgcgtggagcgc
gagctgtacatggagcagctgcgcggccggctcgaatccgagctgcgcgcgcacagcatc
agcgccagcgtgtcgggcaggcccaagcacatctacagcatcgtcaagaagatgcgcggc
aagtcgctcgacttcgaccaggtgttcgacatccgcgcgctgcgcgtgatcgtgcccagc
gtcaaggactgctatgccgcgctgagctgggtgcacagccagttcacctccatcgaggcc
gagttcgacgactacatcgcccgccccaagcccaacggctaccagtcgctgcacacggtg
gtgcgcgacgaggccggcagggccatcgagatccagatccgcacccaggccatgcacgac
catgccgagcacggcgtggctgcgcactgggcctataaggaggcgggcaccaagggctat
gccggcgtgtcggccagcagcgactacgacgccaagatcgccgtgctgcgccagctgctg
gcctgggagcgcgacctggtcggctcggccagccgcagcggcctgttcgaggaccgcatc
tacgtgctgacgcccgacgccgcggtggtggagctgccccagggcgccacgcccgtcgac
ttcgcctatgcggtccacaccaacgtaggccaccgctgccgcggcgcgcgcgtggacggt
gccatggtgccgctgaacacgccgctgcagaacggccagacggtggagatcagcaccgtg
aaggagggccgtccctcgcgcgactggctcaaccccgagctgggctacctcaccagcagc
cgcgccaaggccaaggtgcgcgcctggttcaatgcccaggcgacccacgcgacggtcgcg
cgcgggcgcgaactggtggaaaagctgctgcagcgcgagggcaagacggccatcaagcac
gacgacctggccatgcagctgggattcaagtcggcggacgcgctgttcgagatggtgggc
aaggacgagctgtcgctgcgctccatagaagccctgctgcgcccgcccgagccggtggcg
caggagcccgacctgctggtcaggaaggcgcgcacggccgatggcgcgcacaagggcggc
gtgctcgtggtcggcgtggattcgctcatgacgcagctggccaaatgctgcaagcccgcg
ccgcccgacgacatccgcggtttcgtcacgcgcggcaagggcgtgagcgtgcaccgctcc
gactgccgcaacttccacgaaatggccgcgcgcaacgccgagcgcgtgatcgacgtgcag
tggggccggccgcggcgctcgacggcggaggcggccgtctatcccgtggacgtggcggtg
gaggcatcggaccgccagggcctgctgcgcgacatctccgaggtgttcgcgcgcgagaag
accaacgtgatcggcgtgcagacccagtccgtgaaaggcacggcctggatgaccttcacc
gtggaggtgtccgacgccgggcggctgaacaaggtcctgggcatcgtcgccggcgtgcag
ggggtgcgctcggcgcgcaggcgctaa

DBGET integrated database retrieval system