KEGG   Alicycliphilus denitrificans BC: Alide_1942Help
Entry
Alide_1942        CDS       T01397                                 

Definition
tRNA pseudouridine synthase b
Orthology
K03177  
tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
adn  Alicycliphilus denitrificans BC
Brite
Enzymes [BR:adn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Alide_1942
Transfer RNA biogenesis [BR:adn03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Alide_1942
 Prokaryotic Type
    Alide_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2010475..2011479
Genome map
AA seq 334 aa AA seqDB search
MTERAPRVRVQRRPVHGVLLLDKPLGFSSNDALQKVKWLLRAEKAGHTGTLDPLATGVLP
LCFGAATKFSALQLDAPKTYEAIALLGTTTTTGDAEGEVLERRAVDPAQLTPERLAEVQR
QFTGPIRQVPPMHSALKKDGKALYEYARAGVEVERPARDVTIHALNLALTLAGQAQAAIK
ITVTCSKGTYIRTLGEDIGGALGCGAHLTFLRRLDTGGLGVERCVTLAQIEALDEDARLG
LLQPVQTLLAGHAVVTLGEQDAGRFLSGMRRRGPWPDAGAVAVYGERPHALLGVGHVLQG
ELIPDRLLSPLEIQQILQGAPRAHIERGTLETTL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgctccccgtgtccgggtgcagcggcgcccggtgcacggagtgctgctg
ctcgacaaacccctgggcttttccagcaacgacgccttgcaaaaggtgaagtggctgctg
cgcgccgaaaaggctggccacaccggcacgctcgacccgctggcgaccggcgtgctgccg
ctgtgctttggcgcggcgaccaagttcagcgcgttgcagctggacgcgcccaagacctat
gaggccatcgccctgctgggcaccaccaccaccactggcgacgccgagggcgaggtgctg
gagcggcgcgccgtcgatcccgcccagctcacgcccgagcgcctggccgaggtgcagcgg
cagttcaccggccccatccgccaggtgccgcccatgcacagcgccctgaagaaggacggc
aaggcgctgtacgaatacgcgcgtgccggggtcgaggtcgagcgtcccgcgcgcgatgtc
acgattcatgcattgaatctggctctaacgcttgctggacaagcgcaagcagctatcaaa
ataacagtgacctgtagcaagggcacctacatccgcaccctgggggaggacataggcggg
gcccttggctgcggcgcgcacctcacctttctgcgccgcctggataccggtggcctgggt
gtggagcgctgcgtcacgctggcgcagatcgaggcgctcgacgaggacgcgcgcctgggc
ctgctgcagccggtgcagacgctgctggccggtcatgcggtcgtcaccctgggggagcag
gatgccgggcgcttcctctcgggcatgcgccgccgcggcccctggcccgatgccggcgcc
gtggccgtctacggcgagcgcccgcacgcgctgctgggcgtggggcacgtgctgcagggg
gagctgatccccgaccggcttctgagccccctggagatccaacagattctgcaaggcgcg
ccgcgcgcccacatagaacgcggcacattggaaacaacgctatga

DBGET integrated database retrieval system