KEGG   Alicycliphilus denitrificans BC: Alide_1960Help
Entry
Alide_1960        CDS       T01397                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00020  Citrate cycle (TCA cycle)
adn00190  Oxidative phosphorylation
adn00650  Butanoate metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Module
adn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide_1960
   00650 Butanoate metabolism
    Alide_1960
  Energy metabolism
   00190 Oxidative phosphorylation
    Alide_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADU99703
JGI: Alide_1960
UniProt: E8TYB7
Position
complement(2028184..2028549)
Genome map
AA seq 121 aa AA seqDB search
MSATYGYKRTVVGAHYGWRDFLVQRITAVLIGVFTLLVLCKLLFTSGPIGYDTWAGIFAP
QWMKALTFSVIVAVIWHAWVGVCSVWYDYAKPAGLRLVLQALSIIWLVSCGGWAVQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaacctacggctacaagcgcaccgtcgtcggcgcccattacggttggcgcgac
ttcctggtgcaacgcatcaccgccgtgctgatcggcgtgttcaccctgctggtgctgtgc
aagctgctgttcacctcgggccccatcggctacgacacctgggccggcatcttcgcgccg
cagtggatgaaggcgctcacgttctccgtcatcgtcgcggtgatctggcatgcctgggtg
ggcgtgtgcagcgtctggtacgactacgccaagccggccggtctgcgcctcgtgctgcaa
gccctgtcgatcatctggctggtcagctgcggcggctgggccgtgcaggtgctgtggcgc
ctgtga

DBGET integrated database retrieval system