KEGG   Alicycliphilus denitrificans BC: Alide_1960Help
Entry
Alide_1960        CDS       T01397                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide_1960
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide_1960
   00650 Butanoate metabolism
    Alide_1960
  Energy metabolism
   00190 Oxidative phosphorylation
    Alide_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2028184..2028549)
Genome map
AA seq 121 aa AA seqDB search
MSATYGYKRTVVGAHYGWRDFLVQRITAVLIGVFTLLVLCKLLFTSGPIGYDTWAGIFAP
QWMKALTFSVIVAVIWHAWVGVCSVWYDYAKPAGLRLVLQALSIIWLVSCGGWAVQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaacctacggctacaagcgcaccgtcgtcggcgcccattacggttggcgcgac
ttcctggtgcaacgcatcaccgccgtgctgatcggcgtgttcaccctgctggtgctgtgc
aagctgctgttcacctcgggccccatcggctacgacacctgggccggcatcttcgcgccg
cagtggatgaaggcgctcacgttctccgtcatcgtcgcggtgatctggcatgcctgggtg
ggcgtgtgcagcgtctggtacgactacgccaagccggccggtctgcgcctcgtgctgcaa
gccctgtcgatcatctggctggtcagctgcggcggctgggccgtgcaggtgctgtggcgc
ctgtga

DBGET integrated database retrieval system