KEGG   Alicycliphilus denitrificans BC: Alide_2497Help
Entry
Alide_2497        CDS       T01397                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00790  Folate biosynthesis
adn01100  Metabolic pathways
Module
adn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alide_2497
Enzymes [BR:adn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Alide_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADV00231
JGI: Alide_2497
UniProt: E8TQZ5
Position
complement(2576562..2577458)
Genome map
AA seq 298 aa AA seqDB search
MLWQTSRFDLDLTRPRVMGIVNVTPDSFSDGGRHAGTQAALRHCERLLEEGADILDIGGE
STRPGSPAVPLAEELERVVPLVREAVRLGAPISVDTYKPEVMQAVLDLGADIVNDIWALR
QPGAAQVVARHARCGVCLMHMHRDPQTMQSAPMEGDVVLQVFSFLERAALDLRTLGVEKS
RIVLDCGIGFGKTVEQNFTLLARQQELLALGHPLLAGWSRKSSLGSVTGLPVQERLVPSV
AAAVLAVERGARIVRVHDVRETVAALAVWQAVRSQSHGAAPADARPTPIDKEEPGHDA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgctctggcaaacctcccgcttcgacctggacctgacgcgcccgcgggtcatggggatc
gtcaacgtcacgcccgactccttctcagacggcggccggcacgccggcacgcaggccgcg
ctgcgccactgcgagcggttgctggaggagggggccgacatcctcgacatcggcggcgag
tccacccgccccggcagcccggccgtgcccctggccgaggagctcgagcgcgtcgtgccg
ctggtgcgcgaggccgtgcgcctgggggcccccatttccgtcgatacttacaagcccgag
gtcatgcaggccgtgctggacctgggggccgacatcgtcaacgacatctgggccctgcgc
cagcccggggcggcgcaggtcgtcgcgcgccatgcgcgctgcggcgtgtgcctgatgcac
atgcaccgcgacccgcagaccatgcaaagcgcgcccatggagggcgacgtggtgctccaa
gtgttctcgttcctggagcgcgcggcgctggacctgcggaccctgggggtcgaaaagtcc
cgcatcgtgctggactgcggcatcggcttcggcaagaccgtggagcagaacttcaccctg
ctcgcgcgccagcaggaactgctggcactgggtcatccgctgctggccggctggtcgcgc
aagtcgtcgctgggcagcgtcacgggcctgcctgtgcaggagcgcctggtgcctagcgtc
gcggccgcggtgctggccgtggagcggggggcgcgcatcgtgcgcgtgcacgacgtgcgc
gagaccgtcgcggccctggccgtctggcaggcggtgcgatcgcagagccatggcgcagcc
cctgcggatgcgcgaccaacacccatcgacaaggaagaaccaggccatgacgcgtaa

DBGET integrated database retrieval system