KEGG   Alicycliphilus denitrificans BC: Alide_2544Help
Entry
Alide_2544        CDS       T01397                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Alide_2544
Enzymes [BR:adn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Alide_2544
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Alide_2544
Lipid biosynthesis proteins [BR:adn01004]
 Fatty acid synthase
  Component type
   Alide_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2616291..2616944
Genome map
AA seq 217 aa AA seqDB search
MRMFRRDFIAAGALALLGTAPALAQQSRKAAARAPVILVVGDSLSAEYGLPRGSGWVALL
EKRLAQEKIGATVVNASVSGDTTAGGRARLPALLRQHGPTHVVIELGANDALRGLPLTNT
RDNLAWMVEQSQAAGARVLLVGMQMPPNYGADYARRFAALFEAVAKERKVPLVPFLLHGI
ADVPDSTALFQPDRIHPRAEAHPRMLDNVWPQLRKLL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgtttcggcgtgactttatcgcggccggcgccctggccctgctcggcacggcg
cctgcgctcgcgcagcagagccgcaaggccgccgccagggcccccgtgatcctggtggtg
ggcgactcgctcagcgccgaatacggcctgccgcgcggcagcggctgggtggcgctgctg
gagaagcggctggcccaggaaaagatcggcgccacggtggtcaacgctagcgtgagcggc
gacaccacggccggcggccgcgcgcgattgcctgcgctgctcaggcagcacggccccacg
cacgtggtgatcgagctgggcgccaacgacgcgctgcgcggcctgcccctgaccaacacc
cgggacaacctggcatggatggtcgagcagtcacaggccgccggcgcgcgcgtgctgctg
gtgggcatgcagatgccgcccaactacggtgccgactacgcacgccgcttcgccgccctg
ttcgaggccgtggccaaggaacgcaaggtcccgctggtgccgttcctgctgcatggcatt
gccgacgtgccggactccacggcgctgttccagcccgaccgcatccatccgcgcgccgag
gcgcatccgcgcatgctcgacaatgtgtggccgcagctgcgcaagctgctgtga

DBGET integrated database retrieval system