KEGG   Alicycliphilus denitrificans BC: Alide_2562Help
Entry
Alide_2562        CDS       T01397                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide_2562
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_2562
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide_2562
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2634677..2635885
Genome map
AA seq 402 aa AA seqDB search
MTASTDFAPMPDAQGFFGPYGGQLVPPHLKQAMDDINAAYAEITRRQDFQDELAQLFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVAVTRGAATLKEAVD
SAFEEYLTNPTDYLYAIGSVVGPHPFPMMVRDFQSIVGREAREQFQARHGRLPDYVAACV
GGGSNAMGIFTAFLNDTGVKLVGVEPSGEGTDKPGRHAATLSMGKPGEIHGMKCYVLEDA
AGQPAAVHSIASGLDYPGVGPQHSYLKDIGRVQYEAVTDKECLEAFMTLSRVEGIIPALE
SAHAVAWAMRVAPGLPKDQHILVNLSGRGDKDADYVAKVLGI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctctaccgacttcgcccccatgcccgacgcccagggcttctttggtccctat
ggcggccagctggtgccgccgcacctcaagcaggctatggacgacatcaacgccgcctat
gccgaaatcacccgccggcaggacttccaggacgagctggcgcagctgtttgccgactac
gtgggccggcccagcccgatcttccacgccaggcggctgtcggagcagctgggcggcgcg
cagatccacctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaaccactgc
ctgggcgaggccctgctggccaagttcatgggcaagaagaaggtgatcgccgagaccggc
gccggccagcacggcgtggcgctggccacggcctgcgcgctggtgggcattccgtgcgag
atccacatgggccaggtggacatcgagaaggagcaccccaacgtcaccaagatgcgcatc
ctgggctgcaagctcgtggcggtgacgcgcggcgcggccacgctgaaggaggccgtggac
agcgcgttcgaggaatacctgaccaaccccaccgactacctctacgccatcggctcggtc
gtcggcccgcacccgttcccgatgatggtgcgcgacttccagagcatcgtcggccgcgag
gcgcgcgagcagttccaggccaggcatggccgcctgcccgactacgtggcggcctgcgtg
ggcggcggcagcaacgccatgggcatcttcacggccttcttgaacgataccggcgtgaag
ctggtgggcgtagagccctcgggcgaaggcacggacaagcccggccgccacgcggcgacg
ctgagcatgggcaagcccggcgagatccacggcatgaagtgctacgtgctggaagacgcc
gcaggccagccggccgcggtgcacagcatcgcctccggcctggactaccccggcgtgggc
ccgcagcacagctacctcaaggacatcggccgcgtgcagtacgaggcggtgaccgacaag
gaatgcctggaggcattcatgaccttgtcgcgcgtggagggcatcatccccgcgctggag
agcgcccacgccgtggcctgggccatgcgcgtggcgcccggcctgccgaaggaccagcac
atcctggtcaacctctcgggccgcggcgacaaggacgcggactacgtggccaaggtgctg
ggcatctga

DBGET integrated database retrieval system