KEGG   Alicycliphilus denitrificans BC: Alide_2669Help
Entry
Alide_2669        CDS       T01397                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00020  Citrate cycle (TCA cycle)
adn00310  Lysine degradation
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
adn01200  Carbon metabolism
Module
adn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide_2669
  Amino acid metabolism
   00310 Lysine degradation
    Alide_2669
Enzymes [BR:adn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Alide_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADV00401
JGI: Alide_2669
UniProt: E8TTC7
Position
complement(2759045..2760301)
Genome map
AA seq 418 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAEL
LVGDGGTVVSDQPIARIDTEGKAGAAAPAAAAPAAAAPAAAAAAPAAAGGGKGDVAMPAA
AKILAENNLSAAQVAGSGKDGRVTKGDALAAVAGGVKSTAAVIPTGVPAKALPQVAAPSS
ALDLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMELRKKFQDAFTKE
HGVKLGFMSFFVKAAVHALKKYPVLNASVDGTDIVYHGYFDIGIAVGSPRGLVVPILRNA
DQMSFADIEKKIAEFGKKAGEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAILG
VHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtagaagtcaaggttccccagctgtccgagtccgtggccgaggccacgctg
ctgcagtggaagaagaagcccggcgaggccgtcgcccaggacgagatcctgatcgagatc
gagaccgacaaggtggtgctggaagtgccggccccgtccgccggcgtgctggccgagctg
ctggtgggtgatggcggcacggtcgtgtccgaccagcccatcgccaggatcgacaccgag
ggcaaggccggcgccgccgcgcccgccgctgcagcgcctgccgcagcggcccccgcggcg
gctgccgccgcaccggccgccgccggcggcggcaagggcgacgtggccatgcccgccgcc
gccaagatcctggccgagaacaacctgtcggccgctcaggtggccggcagcggcaaggat
ggccgcgtcaccaagggcgacgccctggcggccgtggccggtggcgtcaagtccaccgcc
gccgtgatccccaccggcgtgcccgccaaggcgctgccccaggtggcggctccgtcatcg
gccctggacctgggcgagcgccccgagcagcgcgtacccatgagccgcctgcgcgcccgc
gtggccgagcgcctgctgcagtcgcaatccaccaacgccatcctgaccaccttcaacgag
gtcaacatggccccggtgatggagctgcgcaagaagttccaggatgcgttcaccaaggaa
cacggcgtgaagctcggcttcatgtccttcttcgtcaaggctgcggtgcacgcgctcaag
aagtacccggtgctcaacgccagcgtggacggcaccgacatcgtctaccacggctacttc
gacatcggcatcgccgtcggttcgccgcgcggcctggtggtgcccatcctgcgcaacgcc
gaccagatgagcttcgccgacatcgagaagaagatcgccgagttcggcaagaaggccggc
gaaggcaagctgggcatcgaggagatgaccggcggcacgttctcgatcagcaacggcggc
accttcggctcgatgatgtccacccccatcatcaacccgccgcagtcggccatcctgggc
gtgcacgccaccaaggaccgcgccgtggtcgagaacggccaggtcgtggtgcgtccgatg
aactacctggccatgtcctacgaccaccgcatcatcgacggccgcgaggccgtcctgggc
ctggtggccatgaaggacgcgctggaggatccctcgcgcctgctgttcgacctgtga

DBGET integrated database retrieval system