KEGG   Alicycliphilus denitrificans BC: Alide_2821Help
Entry
Alide_2821        CDS       T01397                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Alide_2821
   00052 Galactose metabolism
    Alide_2821
   00500 Starch and sucrose metabolism
    Alide_2821
   00520 Amino sugar and nucleotide sugar metabolism
    Alide_2821
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Alide_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2921875..2922759
Genome map
AA seq 294 aa AA seqDB search
MTTSPIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVTG
RSKRAIEDHFDTAYELENELEQAGKKEMLELVRSIAPADMNCLFVRQPRSLGLGHAVLCA
EPLVGDEPFAVLLADDLMVGEDGGPGVMAQMTAAFAKQGRSLLAVQEVPQEHTRRYGIVK
GEAAGGALMRVDEIVEKPAPEVAPSRMGVAGRYVLTPRIFEEIRNQPRGVGGEIQLTDAI
ARLMQQETVYAYQYSGKRYDCGSKEGFLEATVELALKHPQVGAQFRDYLRSLEL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccccatccgcaaggccgtcttccccgttgccggcctgggcacgcgcttc
ttgcccgccaccaaggccagccccaaggaaatgctgccggtggtcgacaaaccgctgatc
cagtacgccgtcgaagaagcctacgaggcggggatacgcgacatggtgttcgtcaccggc
cgcagcaagcgcgccatcgaggaccacttcgacaccgcctacgaactcgaaaacgagctg
gagcaggccggcaagaaggaaatgctggagctggtgcgcagcatcgcccctgccgacatg
aactgcctgttcgtgcgccagccgcgcagcctgggcctgggccatgccgtgctgtgcgcc
gagcccctggtcggcgacgagccctttgccgtgctgctggccgacgacctgatggtgggt
gaggacggcggccccggcgtgatggcgcagatgaccgccgcgttcgccaagcagggccgc
tccctgctggctgtgcaggaggtgccgcaggagcacacgcgccgctacggcatcgtgaag
ggcgaggccgccggcggcgccctgatgcgcgtggacgagatcgtggagaagcccgcgccc
gaggtcgccccctcgcgcatgggcgtggccggccgctacgtgctcaccccgcgcatcttc
gaggagatccgcaaccagccgcgcggcgtgggcggcgagatccagctcaccgacgccatc
gcgcgcctgatgcagcaggagaccgtctacgcttaccaatacagcggcaagcgctacgat
tgcggtagcaaggaaggcttcctggaggccacggtcgagcttgccctgaagcacccgcag
gtgggcgcgcagttccgcgactacctgcgctcactggagctgtaa

DBGET integrated database retrieval system