KEGG   Alicycliphilus denitrificans BC: Alide_3046Help
Entry
Alide_3046        CDS       T01397                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
adn  Alicycliphilus denitrificans BC
Brite
Enzymes [BR:adn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Alide_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: ADV00772
JGI: Alide_3046
UniProt: E8TXK4
Position
complement(3165222..3165995)
Genome map
AA seq 257 aa AA seqDB search
MQRRPGFPARIDWTKDAAPAASLAPARVRREAPPPTPQGVGLDSAAVRARMVQRLAAAGI
TAVPVLQAMGNVERHRFVDTALVNQAYEDTSLPIGLGQTISKPSVVARMTELLLGAQCAR
AGGLGRVLEIGTGCGYQAAVLARLAREVYTIERLRALHEKARENLRPLRLANVHLILGDG
MLGYAGGAPYAGIISAAGGGSLPPQWCEQLAMGGRLVAPMAGVDGRQMLLVVDKTPKGLE
QTVLEAVHFVPLKSGVV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgccccggattccccgcgcgcatcgattggacgaaggatgcggcgccggct
gcctccctcgcgccggcgcgtgtccggcgcgaggcgccgccgcccacaccccagggcgtt
ggcctggattcggccgcggtacgggcgcgcatggtgcagcggctggcggcggcgggcatc
accgcggtgccggtgctgcaggccatggggaacgtggagcggcaccgcttcgtcgatacc
gccctggtcaaccaggcctacgaggacaccagcctgcccatagggctgggccagaccatc
tccaagcccagcgtggtggcgcgcatgaccgagctgctgctgggcgcgcagtgcgcgcgc
gcgggcggcctggggcgggtgctggagatcggcaccggctgcggctaccaggcggccgtg
ctggcgcggctggcgcgcgaggtgtacaccatagagcgcctgcgcgcgttgcatgaaaag
gcgcgcgagaacctgcgccccttgcgcttggcaaacgtccatctgatcctgggcgacggc
atgctgggctatgccggcggcgcaccctatgcgggcatcatttccgcggcgggcggcggc
agcctcccgccgcagtggtgtgagcagcttgccatgggggggcgcctcgtggcccccatg
gcgggggtggacgggcgccagatgttgctcgtggttgacaaaacgccgaaaggcctggag
cagacggtgctcgaagccgtgcatttcgtccccctaaaatcgggggtcgtttga

DBGET integrated database retrieval system