KEGG   Alicycliphilus denitrificans BC: Alide_3048Help
Entry
Alide_3048        CDS       T01397                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3166882..3168462
Genome map
AA seq 526 aa AA seqDB search
MKLRSVTLRTLCIFLPILQMDSAKSPSEVARETLKLLAARRLSPTPDNYQALYEEVSGVR
TAPNFPTAQLRHILHVMPGQTPGQKRLLGQLENAVAQQDWSMLKNVLVGYANLGLSPVAT
PPPASVSITQLPTTLAQNLARLVSNTLPALGEDDPRVHELAAQLCAFLREPERPIATAEL
MLSDFSYRLSFAAEDQAAIRQGLLGLLRLVFENIAALSIDEPWLHGQAEALLAASTPPLT
LRRLDDVHKRLKDVIFKQSEAKDRTVQAQTQMRELLATFIERLAQMDESSSTYNETMERC
AERIGRATQLQDIMPLLEEVMAATRAMALNSRVTRSELQDLRERTEATHAEITQLRRDLD
HASAQARHDPLTGALNRKGLDEAMEREIARAFRLDTPLCVALLDVDNFKAINDRLGHAAG
DEALMHLVRVTREVMRPQDQLARHGGEEFVLILPNTQLADGVKAMERLQRELTKRYFLKE
QERLLITFSAGVAQVEGKNGSADAIRRADEGMYLAKRSGKNRVVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcgctctgtcacacttcgcactctttgcatcttcctgcccatcctgcagatg
gactccgccaaatctccttccgaagtcgcgcgtgaaaccctcaagctcctggccgcgcgc
cgcctctcccccacccccgacaattaccaggccctgtacgaagaggtgtcgggcgtccgc
accgcgccgaattttcccaccgcacagctgcgccatattctgcatgtgatgccggggcag
acccccgggcagaagcgcctgctgggccagctggagaacgccgtcgcgcagcaagactgg
tccatgctgaaaaacgtgctggtgggctacgccaacctgggcctgtcgccagtcgccacg
ccgccgcccgccagcgtcagcatcacccagctgcccaccacgctggcgcagaacctggca
cgcctggtgagcaacaccctgccggccctgggcgaagacgacccccgcgtgcacgagctg
gccgcgcagctgtgcgccttcctgcgcgagcccgagcgccccatcgccacggccgaactg
atgctgagcgacttcagctatcgcctgtccttcgccgcggaggaccaggccgccatacgg
cagggcctgctcgggctgctgcgcctggtattcgagaacattgccgcgctgagcatcgac
gagccatggctgcacggccaggccgaggcgctgctggccgcatccacgccgccgctcacg
ctgcgtcggctcgacgacgtgcacaagcgcctcaaggacgtgatcttcaagcagtccgag
gccaaggaccgcacggtccaggcacagacgcagatgcgcgagctgctggccaccttcatc
gagcgcctggcgcagatggacgaatcgagcagcacctacaacgaaaccatggagcgctgt
gccgaacgcatcggccgtgcgacgcagctgcaggacatcatgccgctgctcgaggaagtc
atggccgccacccgcgccatggcgctgaacagccgcgtgacgcgctccgagctgcaggac
ctgcgcgagcgcaccgaggccacgcatgccgagatcacccagctgcgccgcgacctggac
cacgcgagcgcccaggcccgccacgacccgctgaccggagccctgaaccgcaaggggctg
gacgaggccatggagcgcgagatcgcgcgcgcgttccgcttggataccccgctgtgcgtg
gccctgctcgacgtggacaacttcaaggccatcaacgaccgcctgggccatgccgcaggc
gacgaggcgctgatgcacttggtccgggtcacgcgcgaggtcatgcggccccaggaccag
ttggcgcgccacggcggcgaggagttcgtgctcatcctgcccaacacccagctcgccgac
ggcgtgaaagccatggagcgcctgcagcgcgagctgaccaagcgctacttcctgaaggaa
caggagcgcctgctcatcaccttcagcgccggcgtggcgcaagtggagggcaagaacggc
agcgccgatgccatccgccgcgccgacgagggcatgtacctggccaagcgctcgggcaag
aaccgcgtggtggctgcgtag

DBGET integrated database retrieval system