KEGG   Alicycliphilus denitrificans BC: Alide_3048Help
Entry
Alide_3048        CDS       T01397                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
adn  Alicycliphilus denitrificans BC
Brite
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Alide_3048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3166882..3168462
Genome map
AA seq 526 aa AA seqDB search
MKLRSVTLRTLCIFLPILQMDSAKSPSEVARETLKLLAARRLSPTPDNYQALYEEVSGVR
TAPNFPTAQLRHILHVMPGQTPGQKRLLGQLENAVAQQDWSMLKNVLVGYANLGLSPVAT
PPPASVSITQLPTTLAQNLARLVSNTLPALGEDDPRVHELAAQLCAFLREPERPIATAEL
MLSDFSYRLSFAAEDQAAIRQGLLGLLRLVFENIAALSIDEPWLHGQAEALLAASTPPLT
LRRLDDVHKRLKDVIFKQSEAKDRTVQAQTQMRELLATFIERLAQMDESSSTYNETMERC
AERIGRATQLQDIMPLLEEVMAATRAMALNSRVTRSELQDLRERTEATHAEITQLRRDLD
HASAQARHDPLTGALNRKGLDEAMEREIARAFRLDTPLCVALLDVDNFKAINDRLGHAAG
DEALMHLVRVTREVMRPQDQLARHGGEEFVLILPNTQLADGVKAMERLQRELTKRYFLKE
QERLLITFSAGVAQVEGKNGSADAIRRADEGMYLAKRSGKNRVVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcgctctgtcacacttcgcactctttgcatcttcctgcccatcctgcagatg
gactccgccaaatctccttccgaagtcgcgcgtgaaaccctcaagctcctggccgcgcgc
cgcctctcccccacccccgacaattaccaggccctgtacgaagaggtgtcgggcgtccgc
accgcgccgaattttcccaccgcacagctgcgccatattctgcatgtgatgccggggcag
acccccgggcagaagcgcctgctgggccagctggagaacgccgtcgcgcagcaagactgg
tccatgctgaaaaacgtgctggtgggctacgccaacctgggcctgtcgccagtcgccacg
ccgccgcccgccagcgtcagcatcacccagctgcccaccacgctggcgcagaacctggca
cgcctggtgagcaacaccctgccggccctgggcgaagacgacccccgcgtgcacgagctg
gccgcgcagctgtgcgccttcctgcgcgagcccgagcgccccatcgccacggccgaactg
atgctgagcgacttcagctatcgcctgtccttcgccgcggaggaccaggccgccatacgg
cagggcctgctcgggctgctgcgcctggtattcgagaacattgccgcgctgagcatcgac
gagccatggctgcacggccaggccgaggcgctgctggccgcatccacgccgccgctcacg
ctgcgtcggctcgacgacgtgcacaagcgcctcaaggacgtgatcttcaagcagtccgag
gccaaggaccgcacggtccaggcacagacgcagatgcgcgagctgctggccaccttcatc
gagcgcctggcgcagatggacgaatcgagcagcacctacaacgaaaccatggagcgctgt
gccgaacgcatcggccgtgcgacgcagctgcaggacatcatgccgctgctcgaggaagtc
atggccgccacccgcgccatggcgctgaacagccgcgtgacgcgctccgagctgcaggac
ctgcgcgagcgcaccgaggccacgcatgccgagatcacccagctgcgccgcgacctggac
cacgcgagcgcccaggcccgccacgacccgctgaccggagccctgaaccgcaaggggctg
gacgaggccatggagcgcgagatcgcgcgcgcgttccgcttggataccccgctgtgcgtg
gccctgctcgacgtggacaacttcaaggccatcaacgaccgcctgggccatgccgcaggc
gacgaggcgctgatgcacttggtccgggtcacgcgcgaggtcatgcggccccaggaccag
ttggcgcgccacggcggcgaggagttcgtgctcatcctgcccaacacccagctcgccgac
ggcgtgaaagccatggagcgcctgcagcgcgagctgaccaagcgctacttcctgaaggaa
caggagcgcctgctcatcaccttcagcgccggcgtggcgcaagtggagggcaagaacggc
agcgccgatgccatccgccgcgccgacgagggcatgtacctggccaagcgctcgggcaag
aaccgcgtggtggctgcgtag

DBGET integrated database retrieval system