KEGG   Alicycliphilus denitrificans BC: Alide_3077Help
Entry
Alide_3077        CDS       T01397                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Alide_3077
Enzymes [BR:adn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Alide_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3204696..3206630
Genome map
AA seq 644 aa AA seqDB search
MSKKEDLGTETVGMGRRRFINTAALAGLTVGVAACNDKPAASPAASGTPASAPAPAAHAG
SGANVHLKPGELDTYYGLWSGGHNGDVRVLGLPSGREIHRIPCFVPDALVGWGITNESKA
VMGTKPDGNLRYTVADTHHLHASYKDGNYDGRYAWVNDKINARIARIRLDYFVCDKITDL
PNVQGFHGIFPDKADPVDPAINYTTRVFCGGEFAIPLPNDGKDVNAPEKYRSLFTCVDAE
TMEVRWQVLIDGNCDLVATSYDGKLAATNQYNTENGIHYEDMMSAERDACLFFNVARIEE
AVKAGKFKTYGNKVPVVDGTHEANKDPKTALVAYVSVPKNPHGVNASPDGKYFICAGKLS
PTTTTIELAKVLDWFDGKMEKLDDAIVAEVEVGLGPLHTAFDGRGNAYTTLFLDSQIVKW
NVEKAIAFHKGDKNAKYVVDRIDVHYQPGHINASQSETKAADGKFLAVGCKFSKDRFLPV
GPLHPENEQLIDISGEKMVLLADHPVRGEPHDFIIFKRDLLKPKQVYELDEFPLAVKDAK
ESGVFRNGKKVTVKLTSQAPAFSMREFTVKKGDEVTLILTNLDKIEDLTHGFALPKYNIQ
FVINPLETKSVTFVADKPGVFWAYCSTFCHALHLEMRTRMIVEA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaagaagacctgggcaccgaaaccgtcggcatgggccggcgccgtttcatc
aacaccgccgcgctggcgggcctgacggtaggcgtcgctgcttgcaacgacaaacccgcc
gcgtccccggcggcatcgggcacccccgcctccgcgcccgcaccggccgcgcatgccggc
agcggcgcgaacgtgcacctcaagcccggtgagctcgacacctactacggcctgtggagc
ggcggccacaacggcgacgtgcgcgtgctgggcctgccttcgggccgcgagatccaccgc
attccctgcttcgtgcccgacgcgctcgtgggctggggcatcaccaacgaatccaaggcc
gtcatgggcaccaagcccgacggcaacctgcgctacacggtggccgacacccaccacctg
catgcctcgtacaaggacggcaattacgacggtcgctacgcctgggtcaacgacaagatc
aatgcccgcatcgcacgcatccgcctggactacttcgtctgcgacaagatcaccgacctg
cccaacgtgcagggcttccacggcatcttccctgacaaggccgacccggtcgatcccgcg
atcaactacacgacgcgcgtgttctgcggcggcgagttcgccattcccctgcccaacgac
ggcaaggacgtgaatgctcccgagaagtaccgctcgctgttcacctgcgtggacgccgag
accatggaagtgcgctggcaggtgctgatcgacggcaactgcgacctggtcgccacctcg
tacgatggcaagctcgcggccaccaaccagtacaacaccgagaacggcatccactacgag
gacatgatgtccgccgagcgcgacgcctgcctgttcttcaacgtggcgcgcatcgaggag
gccgtgaaggccggcaagttcaagacctatggcaacaaggtgcccgtagtggacggcacg
cacgaggccaacaaggacccgaagacggccctggtcgcctacgtcagcgttccgaagaac
ccgcacggcgtgaacgccagccccgacggcaagtacttcatctgcgccggcaagctctcg
cccaccaccacgaccatcgagctcgccaaggtgctggactggttcgacggcaagatggag
aagctcgacgacgccatcgtcgccgaggtcgaagtgggcctgggccccttgcacaccgcc
ttcgacggccgcggcaacgcctacaccacgctgttcctggacagccagatcgtcaagtgg
aacgtggagaaggccatcgccttccacaagggcgacaagaacgccaagtacgtggtggac
cgcatcgacgtgcactaccagcccggccacatcaacgcatcgcagtccgagaccaaggcc
gccgacggcaagttcctggccgtgggctgcaagttctccaaggaccgcttcctgcccgtg
ggcccgctgcaccccgagaacgagcaactgatcgacatctcgggcgagaagatggtgctg
ctggccgaccacccggtgcgcggcgagccgcacgacttcatcatcttcaagcgcgacctc
ctcaagcccaagcaggtgtacgagctggacgagttcccgctggccgtcaaggacgccaag
gaatcaggcgtgttccgcaacggcaagaaggtcaccgtcaagctcacctcgcaggcgccg
gccttcagcatgcgcgagttcaccgtgaagaagggcgacgaggtcacgctgatcctgacc
aacctggacaagatcgaggacctgacgcacggcttcgccctgcccaagtacaacatccag
ttcgtcatcaacccgctggagaccaagtcggtcaccttcgtggccgacaagcctggcgtg
ttctgggcttactgctccacgttctgccatgcgctgcaccttgagatgcgcacgcgcatg
atcgtcgaggcctga

DBGET integrated database retrieval system