KEGG   Alicycliphilus denitrificans BC: Alide_3147Help
Entry
Alide_3147        CDS       T01397                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alide_3147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_3147
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alide_3147
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alide_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3282301..3283569
Genome map
AA seq 422 aa AA seqDB search
MFEYHQPDASGHFGPYGGSFASETLTHALTELREAYARYQHDPAFLAEFQYELAHFVGRP
SPVYHAARMSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRIIAETGAGQH
GVATATICARYGLQCVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDDTFYIIGTVAGPHPYPVMVRDFQSVIGKECLEQMPAMLAEQKIAAEQPDAVVA
CVGGGSNAMGIFHPYIPFENTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTYILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDKEALDAFHYLCRTEGIIPAL
ESSHAVAHAMKLAKTMTPQQSILVNLSGRGDKDIGTVADLSGADFYDRPSMRGHTVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaataccaccaacccgatgcatcgggccacttcggcccctatggcggcagcttc
gccagcgagaccctgacccatgcgctgaccgagctgcgagaggcctatgcgcgctaccag
cacgatccggcgttcctcgccgaattccagtacgagctggcccatttcgtgggccggccc
tcacccgtctaccacgccgcgcgcatgtcgcgcgagatgggcggcgcgcagatctacctc
aagcgcgaggacctcaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcgcgccgcatgggcaagccgcgcatcatcgccgagaccggcgcgggccagcat
ggcgtggccacggccacgatctgcgcgcgctacggcctgcagtgcgtggtctacatgggc
gccgaggacgtcaagcgccagagccccaacgtctaccgcatgaagctgctgggcgccacc
gtggtgcccgtcgaatccggcagccgcacgctcaaggacgcgctcaacgaggccatgcgc
gactgggtggccaacgtggacgacaccttctacatcatcggcaccgtggccggcccgcac
ccctacccggtgatggtgcgcgacttccagagcgtgatcggcaaggaatgcctcgaacag
atgcccgccatgctggccgagcagaaaatagccgcagagcagcccgacgccgtggtcgcc
tgcgtgggcggcggcagcaacgccatgggcatcttccacccctacatcccgttcgagaac
acgcgcctgatcggcgtggaggccgcgggcgagggcctggacagcggcaagcactccgcc
agcctgcagcgcggcagcagcggcgtgctgcacggcaaccgcacctacatcctgcaggac
gagaacggccagatcaccgagacgcacagcatcagcgccggcctggactaccccggcgtg
ggccccgagcatgcctggctgcaggagatcggccgcgccgaatacgtgggcatcaccgac
aaggaggcgctcgacgccttccactacctgtgccgcaccgaaggcatcatcccggcgctc
gaatccagccacgccgtggcccatgcgatgaagctcgccaagaccatgacgccccagcaa
tccatcctcgtgaacctctccggccgcggcgacaaggacatcggcaccgtggccgacctg
tcgggcgcggacttctacgaccgccccagcatgcgcggccacaccgtcaagggagggccc
gccgcatga

DBGET integrated database retrieval system