KEGG   Alicycliphilus denitrificans BC: Alide_3167Help
Entry
Alide_3167        CDS       T01397                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00010  Glycolysis / Gluconeogenesis
adn00030  Pentose phosphate pathway
adn00051  Fructose and mannose metabolism
adn00052  Galactose metabolism
adn00680  Methane metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_3167
   00030 Pentose phosphate pathway
    Alide_3167
   00051 Fructose and mannose metabolism
    Alide_3167
   00052 Galactose metabolism
    Alide_3167
  Energy metabolism
   00680 Methane metabolism
    Alide_3167
Enzymes [BR:adn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alide_3167
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Alide_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADV00889
JGI: Alide_3167
UniProt: E8TYJ1
Position
complement(3302380..3303447)
Genome map
AA seq 355 aa AA seqDB search
MNMRIGVLTGGGDCPGLNAVIRAVTKSLIQHGHGKGVEVLGILDGFEGLMGDTPRARPLV
WDRVSGILHMGGTILGTSNSANPLKDEATLEQVRRNVRALGLDVVVAIGGDGTMSLAHGL
QKIGLACVGVPKTIDNDIALCERSFGFDTAVATATDALRRVESTANSHHRVMIVETMGRH
AGWLALESGIAGAADVILLPEIDYDLQAIIDRCREREQRQRYTIICIGEGAKPRGGEITV
RERVAGSPDPVRLGGVGHVLRQQLQPHLKSEVRTTVLGYVQRGGDPTPFDRVLATRFGHH
AAQLVIAGQLDRMVTLQDGRIGSVEIARVANTQRKVPPNHDLITMARDIGVCLGD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgcatcggcgtgctcacgggcgggggcgattgccccggcctgaacgcggtg
atccgcgccgtcaccaagtcgctgatccagcatggccacggcaagggggtcgaggtgctg
ggcatcctggacggcttcgagggcctgatgggcgacacgccgcgcgcccggccgctggtg
tgggaccgggtctcgggcatcctgcacatgggcggcaccatcctgggcacgagcaacagc
gccaaccccctgaaggacgaggccacgctggagcaggtgcggcgcaacgtgcgcgccctg
ggcctggacgtggtcgtggccataggcggcgacggcaccatgagcctggcgcacggcctg
cagaaaatcggcctggcctgcgtgggcgtgcccaagaccatagacaacgacatcgcgctg
tgcgagcgcagcttcggcttcgacacggccgtggccacggccaccgacgcgctgcgccgg
gtggagagcacggccaacagccatcaccgcgtgatgatcgtcgagaccatgggccgccac
gcgggctggctggcgctggagagcggcatcgcaggcgcggccgacgtgatcctgctgccc
gagatcgactacgacctgcaggccatcatcgaccgctgccgcgagcgcgagcagcgccag
cgctacaccatcatctgcataggcgagggcgccaagccgcgcggcggcgagatcaccgtg
cgcgagcgcgtggccggcagccccgacccggtgcgcctaggtggcgtgggccacgtgctg
cgccagcagctgcagccgcacctcaagagcgaggtgcgcaccaccgtgctgggctacgtg
cagcgcggcggcgaccccacgccgttcgaccgcgtgctggccacgcgcttcggccatcat
gcggcgcaactggtgatcgccggccagctggaccgcatggtcacgctgcaggacgggcgc
atcggcagcgtggagatcgcccgggtggcgaacacccagcgcaaggtgccgccgaaccac
gacctgatcaccatggcacgcgacatcggcgtgtgcctgggtgattga

DBGET integrated database retrieval system