KEGG   Alicycliphilus denitrificans BC: Alide_3168Help
Entry
Alide_3168        CDS       T01397                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00520  Amino sugar and nucleotide sugar metabolism
adn01100  Metabolic pathways
adn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alide_3168
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Alide_3168
Enzymes [BR:adn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Alide_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ADV00890
JGI: Alide_3168
UniProt: E8TYJ2
Position
complement(3303444..3304526)
Genome map
AA seq 360 aa AA seqDB search
MTEHAPLIIDVAGTQLSADDRRRLAHPLVGGVILFARNWQDRAQLLALTAAIKAVRHDLL
ICVDHEGGRVQRFRTDGFTHIPPMRAFGELWMNDGKAGQGSGALRAMEAATAAGYVLGSE
LRACGVDFSFTPVLDLDWGESGVIGDRAFHRDPRVVAMLARALMQGLLQAGMANCGKHFP
GHGFVRADSHTEIPVDRRSLKAILQDDAAPYPWLSTVLTSVMPAHVIYPKVDGRPAGFSA
RWLQDILRGRLRFDGAIFSDDLSMEGARRIDGQVVGYTDAGVAALNAGCDLVLLCNQSLG
DGQAVDELIAGLADAQAAGRWQASRASEARRQALLPETLPQPWDDLMVQPAYMHALDLLP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatgcacccctcatcatcgacgtggccggcacgcagctgagcgccgacgac
cgccgccgcctggcccacccgctcgtgggcggcgtgatcctgttcgcgcgcaactggcag
gaccgcgcgcagctgctcgcgctcacggccgccatcaaggccgtgcgccacgacctgctg
atctgcgtggaccacgagggcgggcgcgtgcagcgctttcgcaccgacggcttcacccac
atcccgcccatgcgcgctttcggcgaactgtggatgaacgacggcaaggcggggcagggc
agcggcgcgctgcgcgccatggaggcggccacggcggcgggctacgtgctgggcagcgag
ctgcgcgcctgcggcgtggacttttccttcacgcccgtgctggacctggattggggcgag
agcggcgtgatcggcgaccgcgcgttccaccgcgacccgcgcgtggtcgccatgctggcg
cgcgcgctcatgcaggggctgctgcaggcgggcatggccaactgcggcaagcatttcccg
ggccacggcttcgtccgggccgactcgcacaccgagatcccggtggaccggcgcagcctc
aaggccatcctgcaggatgacgcggcgccgtacccgtggctgtccaccgtgcttaccagc
gtcatgccggcgcacgtcatctatcccaaggtggacggccgccccgcgggcttctcggcc
aggtggctgcaggacatattgcgcggccggctgcgcttcgacggcgccatcttcagcgat
gacctgagcatggagggcgcgcggcgcatcgatggccaggtggtcggctacaccgacgcg
ggcgtggccgcgctcaatgccggctgcgacctggtgctgctgtgcaaccagagcctgggc
gacggccaggccgtggacgaactcatagccggcctggccgacgcccaggccgcgggccgc
tggcaggccagcagggccagcgaggcgcgccgccaggcgctgctgcccgagaccctgccg
cagccctgggacgacctcatggtgcagccggcctacatgcacgcgctggacctgctgcca
tga

DBGET integrated database retrieval system