KEGG   Alicycliphilus denitrificans BC: Alide_3269Help
Entry
Alide_3269        CDS       T01397                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00260  Glycine, serine and threonine metabolism
adn00750  Vitamin B6 metabolism
adn01100  Metabolic pathways
adn01110  Biosynthesis of secondary metabolites
adn01120  Microbial metabolism in diverse environments
adn01230  Biosynthesis of amino acids
Module
adn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_3269
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Alide_3269
Enzymes [BR:adn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Alide_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADV00991
JGI: Alide_3269
UniProt: E8TZZ2
Position
complement(3413598..3415028)
Genome map
AA seq 476 aa AA seqDB search
MNYLSTRGDATSRKFCDILLEGLAPDGGLYLPERYPQVSDAQLTELRGAYRSQGYAELAF
RILSLYIDDIPPADLKRLCEKTYMAEVFGTREIVPLRHLEEGLWIEALSNGPTLAFKDMA
MQLLGNLFEYELARRGEQLNILGATSGDTGSAAEYAMRGKRGVRVFMTSPHGRMSPFQQA
QMFSLQDANIHNLAIEGVFDDCQDIVKAVSSDHAFKARYKIGTVNSINWARLLAQVVYYF
AGYFQATQTNAQKVSFTVPSGNFGNICAGHVARQMGLPIDRLVVATNENDVLDEFFRTGA
YRVRGAADTHETSSPSMDISKASNFERFVFDLVGRDGARTRQLFAEGVARQGFFDLGTDP
VFQDARAKYGFESGKSTHADRLATIRDTYERFGQIIDTHTADGVKVARERRGDPAVPMIV
LETALPIKFAETIQEALGRAPERPAKFEGIEQLPKRVQVLPADAERVKAYIAAHCD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctctccacccgtggcgacgccacctcccgcaagttctgcgacatcctgctc
gaaggcctggcgcccgacggcggcctgtacctgcccgagcgctatccccaggtcagcgac
gcccagctcaccgagctgcgtggggcttatcgcagccagggctatgcggaactcgccttc
cgcatcctctcgctctatatcgacgacatcccgcccgccgacctcaagcgcctgtgcgag
aagacgtacatggccgaggtcttcggcacgcgcgagatcgtgccgctgcgccacctggaa
gagggcctgtggatcgaggccctgtccaacggccccacgctggccttcaaggacatggcc
atgcagctgctgggcaacctgttcgagtacgagctggcccgccgcggcgagcagctcaac
atcctgggggccaccagcggcgacaccggcagcgcggccgagtacgccatgcgcggcaag
cggggcgtgcgcgtgttcatgaccagcccgcacgggcgcatgagccccttccagcaggcg
cagatgttcagcctgcaggacgcgaacatccacaacctcgccatcgagggcgtgttcgac
gactgccaggacatcgtcaaggcggtgagcagcgaccacgcgttcaaggccaggtacaag
atcggcaccgtcaactcgatcaactgggcgcggctgctcgcgcaggtggtctactacttc
gcgggctacttccaggccacgcagaccaacgcgcagaaggtcagcttcaccgtgcccagc
ggcaacttcggcaacatctgcgccggccatgtggcgcgccagatgggcctgcccatcgac
cgactggtcgtcgccacgaacgagaacgatgtgctcgacgagttcttccgcaccggcgcg
taccgcgtgcgcggcgcagccgacacgcacgagaccagcagccccagcatggacatcagc
aaggccagcaacttcgagcgcttcgtgttcgacctggtcggccgcgacggtgcacgcacg
cgccagctgttcgccgaaggcgtggcccggcagggcttcttcgacctggggacggacccg
gtgttccaggacgcccgagccaagtacggcttcgagagcggcaagagcacgcacgccgac
cgcctggcgacgatccgcgatacctacgagcgcttcggccagatcatcgatacccacaca
gccgacggcgtgaaagtggcgcgcgagcggcgcggcgaccccgccgtgcccatgatcgtg
ctggagacggccctgcccatcaagttcgccgaaactatccaggaggccctgggccgcgcg
cccgagcgcccggcgaagttcgagggcatagagcagctgcccaagcgcgtgcaggtgctg
ccggccgacgccgagcgggtcaaggcctacatcgcagcccattgcgattga

DBGET integrated database retrieval system