KEGG   Alicycliphilus denitrificans BC: Alide_3335Help
Entry
Alide_3335        CDS       T01397                                 

Definition
(GenBank) Malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
adn00410  beta-Alanine metabolism
adn00640  Propanoate metabolism
adn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Alide_3335
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Alide_3335
Enzymes [BR:adn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Alide_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-ProteinID: ADV01055
JGI: Alide_3335
UniProt: E8U056
Position
complement(3480665..3482092)
Genome map
AA seq 475 aa AA seqDB search
MNAATTWISRSVDRLRPGADKKEKEPAAERSTHERLQASLRKSGEALSPRALRRMLADLQ
DVVAPRVSEIEGGRRAQAVADWYAGAEPAERRDMWLLMCEQFAPDATRFKSAQQRYEAAA
GTADAPQAEAHLRRALVSPRTRLLQRFAVFPDGMRFLVDLRAELLPLLKSDKRLLPLEAE
LEQLFATWFDVAFLELRRLSWDSPASLIEKLIKYEAVHDIRSWADLKNRLDSDRRCYGFF
HPRLPNEPLIFVEVALVNEISESITPLLDESAEAADIQRATTAIFYSISSTQTGLRGVSF
GDSLIKHVAETLTEEFPRLRTFATLSPIPGFRSWLAKQGAAQLERLDEKQRVELGRAVGF
MPPQIAHVLAAADKALELPPKSPVRQLLQQCAARYLGRELQDGKPLDAVARFHLGNGARV
ERLNWAADPSAKGMKQSFGMMVNYLYDLKRIDKHRALLEEGRVPVSGDIESLCGD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagccaccacctggatttcgcgcagcgtcgaccgcctgcggcccggcgccgac
aagaaggagaaggagcccgccgccgagcgctccacccacgaacgcctgcaggcctccctg
cgcaagagcggcgaggctttgtcgccgcgcgcgctgcgccgcatgctggccgacctgcag
gacgtggtggccccgcgcgtgagcgagatcgagggcggccgccgcgcccaggccgtggcc
gactggtacgccggggccgagcctgcggagcggcgcgacatgtggctgctgatgtgcgag
cagttcgcgcccgacgccacgcgcttcaagtccgcccagcagcgctacgaggccgccgcc
ggcacggccgacgcgccccaggccgaggcccacctgcgccgcgcgctggtgtcgccgcgc
acgcggctgctgcagcgcttcgccgtgttccccgatggcatgcgcttcctggtggacctg
cgcgccgagctgctgccgctgctcaagagcgacaagcggctgctgccgctggaggcggag
ctcgagcagcttttcgccacctggttcgacgtggccttcctggagctcaggcgcctgtcg
tgggactcgcccgcctcgttgatcgagaagctcatcaagtacgaggcggtgcatgacatc
cgcagctgggcggacctgaagaaccgcctggacagcgaccggcgctgctacggcttcttc
cacccccgcctgccgaacgagccgctgatcttcgtggaggtggcgctcgtcaatgagatc
tccgaaagcatcacgccgctgctggacgagtcggccgaggccgccgacatccagcgcgcg
accacggccatcttctattcgatcagcagcacccagacggggctgcgcggcgtgagcttc
ggcgactcgctcatcaagcatgtcgcggagacgctgaccgaggagttcccgcgcctgcgc
accttcgccacgctgtcgcccattccgggcttccgctcctggctggccaagcagggcgcg
gcgcagctcgagcggctcgacgaaaagcagcgggtcgagctgggccgcgccgtgggcttc
atgccgccgcagatcgcccatgtgctggccgcggccgacaaggcgctggagctgcccccg
aagtcgcccgtgcgccagctgctgcagcaatgcgcggcgcgctacctgggccgcgagctg
caggacggcaagcccctggacgccgtggcgcgctttcacctgggcaacggcgcgcgcgtg
gagcggctcaactgggcggccgacccttcggccaagggcatgaagcagtccttcggcatg
atggtcaactacctgtacgacctcaagcgcatcgacaagcaccgcgcgctgctcgaggag
ggcagggtgcccgtgtcgggcgacatagaaagcctgtgcggcgattga

DBGET integrated database retrieval system