KEGG   Alicycliphilus denitrificans BC: Alide_3438Help
Entry
Alide_3438        CDS       T01397                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alide_3438
   01230 Biosynthesis of amino acids
    Alide_3438
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alide_3438
  Energy metabolism
   00680 Methane metabolism
    Alide_3438
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alide_3438
Enzymes [BR:adn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Alide_3438
Exosome [BR:adn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Alide_3438
  Exosomal proteins of melanoma cells
   Alide_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3591705..3592448
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGIEQAKNAGRLLKAEGYEFDLAYTSVLKR
ATRTLWHCLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPTDPRCERGDIRYAGLAPEQVPLTECLKDTVARVLPYWNEAIAPTIRSGKRVLIA
AHGNSIRALVKYLDGISDQDIVGLNIPNGIPLVYELDAELKPLRSYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatccgccacggcgaatccacgtggaatctcgaaaaccgtttc
accggctggaccgacgtggatctgaccgaaaccggcatcgaacaggccaagaacgccggc
cgcctgctcaaggccgagggctacgagttcgacctggcctacaccagcgtcctgaagcgc
gccacgcgcacgctgtggcactgtctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctgaacgagcgccactacggcgcgctgcagggcctgaacaaggccgac
atggccaagcagtacggcgacgcgcaggtgctggtgtggcgccgcagctacgacacgccg
ccgccggccctggagcccaccgacccgcgctgcgagcgcggcgacatccgctacgcgggc
ctggcgcccgagcaggtgccgctgaccgagtgcctcaaggacacggtggcgcgcgtgctg
ccctactggaacgaagccatcgcgccaacgatccgctcgggcaagcgtgtgctgatcgca
gcgcacggcaactccatccgcgcgctggtcaagtacctggacggcatctccgaccaagac
atcgtggggctgaacatccccaacggcatcccgctggtgtacgagctggacgcggaactc
aagcccctgcgcagctactacctgggcgacgccgaggccgccgccaaggccgccgccgcc
gtggccgcgcagggcaaggcctga

DBGET integrated database retrieval system