KEGG   Alicycliphilus denitrificans BC: Alide_3625Help
Entry
Alide_3625        CDS       T01397                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Alide_3625
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alide_3625
Enzymes [BR:adn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Alide_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3768940..3769902)
Genome map
AA seq 320 aa AA seqDB search
MLYKRNPQLNKNGELIHLLSIEGLPREIVTHILDTAANFTSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFDIAAKRLSADVFNLDIARSSTAKGETLLDTIDNLTAMAADIFVVRHS
ESGAPYLIAQHVGPHVHVVNAGDGRHSHPTQGLLDMYTIRHYKKDFSNLTVAIVGDVLHS
RVARSDIHGLTTLGAAEVRVVGPRTLVPADMAQMGVRVFHNLEEGIKDCDVVIMLRLQNE
RMSGALLPSSQEYFKSFGLTPEKLLHAKPDAIVMHPGPINRGVEIDSAVVDGPQAVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtacaagcgcaacccccaactcaacaagaacggcgagctgatccacctgctctcg
atcgagggcctgcccagggagatcgtcacgcacatcctggacacggccgccaacttcacc
agcgtcaacgaccgcgaggtcaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacgcgcacgcgcaccaccttcgacatcgcggccaagcgcctg
tcggccgacgtgttcaacctggacatcgcgcgctcctcgacggccaagggcgagaccctg
ctggacaccatcgacaacctgaccgccatggcggccgacatcttcgtcgtgcgccacagc
gagtcgggcgcgccctacctcatcgcccagcacgtgggcccgcacgtgcacgtggtcaac
gccggcgacggccgccactcgcaccccacgcagggcctgctggatatgtacaccatccgc
cactacaagaaggacttctccaacctcacggtggccatcgtgggcgatgtgctgcactcg
cgcgtggcgcgctcggacatccacggcctgaccacgctgggcgcggccgaggtgcgcgtg
gtgggcccgcgcacgctggtgccggccgacatggcgcagatgggcgtgcgcgtgttccac
aacctggaggagggcatcaaggactgcgacgtggtcatcatgctgcgcctgcagaacgag
cgcatgagcggcgcgctgctgccgtcgagccaggaatacttcaagagcttcggcctcacg
cccgagaagctgctgcacgccaagcccgacgccatcgtcatgcacccgggcccgatcaac
cgcggcgtggagatcgactccgccgtggtggacggcccgcaggccgtgatcctgccgcag
gtcaccttcggcatcgctgtgcgcatggcggtcatgtccatcgtggcggggaacgaggct
tga

DBGET integrated database retrieval system