KEGG   Alicycliphilus denitrificans BC: Alide_3650Help
Entry
Alide_3650        CDS       T01397                                 

Definition
disulfide bond isomerase, dsbc/g-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
adn  Alicycliphilus denitrificans BC
Brite
Enzymes [BR:adn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Alide_3650
Secretion system [BR:adn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Alide_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3797734..3798453
Genome map
AA seq 239 aa AA seqDB search
MKLLPSLLAAATLCLGLNASAQEAAIRKTLAERIPQLQQIDEVRTTPMKGLYEVRIGTDL
FYTDAQGNYLIQGELIDTKARRNLTEDRLNKLTAVDFKALPLQDAFTIVHGKGERKLAVF
EDPNCGYCKRFERDMQNVDNVTIYLFLYPILSPDSAEKSRNIWCAKDRAAAWQDHMLRDK
TPTAASCDTAALQRNLAFGRKHKITGTPTLIFADGSRVPGAIGAQDVEKRLASAAAADK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctcccctccctgctggccgccgccaccctgtgcctgggcctgaacgcatcg
gcgcaagaggcggcgatccgcaagaccctggccgagcgcatcccgcagctgcagcagatc
gacgaggtgcgcaccacgccgatgaaggggctttacgaggtgcgcatcggcacggacctg
ttctacaccgatgcccagggcaactacctgatccagggcgagctgatcgacaccaaggcg
cggcgcaacctgaccgaggaccgcctgaacaagctgacggccgtggacttcaaggcactg
ccgctgcaggacgcgttcaccatcgtgcacggcaagggcgagcgcaagctggccgtgttc
gaggaccccaactgcggctactgcaagcgcttcgagcgcgacatgcagaacgtggacaac
gtgaccatttacctgttcctctaccccatcctgagccccgactcggccgagaagtcgcgc
aacatctggtgcgccaaggaccgcgccgccgcctggcaggaccacatgctgcgcgacaag
accccaaccgccgccagctgcgacacggcagcgctgcagcgcaacctggccttcggacgc
aagcacaagatcaccggcacgcccacgctgatctttgccgacggctcgcgcgtgcccggc
gccatcggcgcgcaggacgtggaaaagcgcctggcctcggcagccgccgccgacaagtag

DBGET integrated database retrieval system